LXL04_027954 | RubberDandelionOmics

Gene overview

LXL04_027954

Reference: OH-1004 Chr: Chr06 Coordinates: 27627687-27629882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1080 bp · LXL04_027954|LXL04_027954|OH1004|cDNA

ATGGTGAGGATTTTACCGATGGCGTCGACCATTCGTCCGTCGCTCTCATCCTTAGCCACTACTCGATTTGGTGGTGGCATCTCCATGGTCAATTCTTCAAAGCGCTTCAATTCGCTTCACTTTGCTTCCAGTGTGCAATCCCAATCACAGCATTTTGGTCTTAAAAGCTGTAAGCTCTTTAAACAAGAAGGAAACCGCAAACCTTCCAAAACAATTGTAAACATGACCCAAGGAAGCACTGCAACCACACAAGAAAGCGC...

CDS

Download CDS FASTA

1080 bp · LXL04_027954|LXL04_027954|OH1004|CDS

ATGGTGAGGATTTTACCGATGGCGTCGACCATTCGTCCGTCGCTCTCATCCTTAGCCACTACTCGATTTGGTGGTGGCATCTCCATGGTCAATTCTTCAAAGCGCTTCAATTCGCTTCACTTTGCTTCCAGTGTGCAATCCCAATCACAGCATTTTGGTCTTAAAAGCTGTAAGCTCTTTAAACAAGAAGGAAACCGCAAACCTTCCAAAACAATTGTAAACATGACCCAAGGAAGCACTGCAACCACACAAGAAAGCGC...

Protein

Download Protein FASTA

359 aa · LXL04_027954|LXL04_027954|OH1004|PROTEIN

MVRILPMASTIRPSLSSLATTRFGGGISMVNSSKRFNSLHFASSVQSQSQHFGLKSCKLFKQEGNRKPSKTIVNMTQGSTATTQESALEWVKSDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEERYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGSAFGHFGIAVDDVAKTVDLIKAKGGTVTREPGPVKGGKSIIAFVEDPDGYKFELIERGPTPEPLCQVMLRVGDLDRAITFYEKAFGMELLRRRDNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027954`
TK1151 ID	TkA07G108960
OH-1004 ID	LXL04_027954
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 66.574 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027954

Location Chr06:27627687-27629882 (+)

Description Similar to At1g67280: Probable lactoylglutathione lyase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67280`	Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.	No verified direct reference in this release
`At1g11840`	Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0191700`	Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione (By similarity).	A unique Ni2+ -dependent and methylglyoxal-inducible rice glyoxalase I possesses a single active site and functions in abiotic stress response.2014 · DOI: 10.1111/tpj.12521

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027954 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G11840

ath:AT1G67280

dosa:Os08g0191700

osa:4344858

sfl:SF1678

sfx:S1810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_027954 · OH-1004

Mitochondrion0.045

Rank 2 · LXL04_027954 · OH-1004

Cytoplasm0.025

Rank 3 · LXL04_027954 · OH-1004

Peroxisome0.017

Rank 4 · LXL04_027954 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_027954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00903.32Glyoxalase98-218 aa

PF13669.13Glyoxalase_4100-203 aa

PF18029.8Glyoxalase_6101-219 aa

PF00903.32Glyoxalase230-346 aa

PF13669.13Glyoxalase_4230-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027954	`PF00903.32`	Glyoxalase	98	218	7.6e-49	165.8
LXL04_027954	`PF13669.13`	Glyoxalase_4	100	203	4.1e-17	63.2
LXL04_027954	`PF18029.8`	Glyoxalase_6	101	219	5.9e-10	40.5
LXL04_027954	`PF00903.32`	Glyoxalase	230	346	7.6e-49	165.8
LXL04_027954	`PF13669.13`	Glyoxalase_4	230	324	4.1e-17	63.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W593`	Arabidopsis thaliana	Probable lactoylglutathione lyase, chloroplastic	78.670%	Swiss-Prot	strong database homology
`O65398`	Arabidopsis thaliana	Lactoylglutathione lyase GLX1	75.362%	Swiss-Prot	strong database homology
`Q948T6`	Oryza sativa subsp. japonica	Lactoylglutathione lyase	71.478%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card