LXL04_027551 | RubberDandelionOmics

Gene overview

LXL04_027551

Reference: OH-1004 Chr: Chr06 Coordinates: 18824613-18828969 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2082 bp · LXL04_027551|LXL04_027551|OH1004|cDNA

ATGAAAATGAAGAGGTCAAGGAGTGAAGTTTTTGGTTTGAGGAGGGTAAGACTGCCACACATTTTGTTTGTTGTTGCTGCATTGTATCTGATCGTTGTTTGCTTCAAGTTCTCTGCCTATTTTGAGACGTCGACCAATACTGAGAATGAAGCAGTAAGGAAATATCAGTTAGAAGTGAGTAAGCCATCGTTAGGATCTGCATCTGAGGATGGAAACAGCGAGGCATCACAAAACGACAACAGATTTGAAAAAGTGAAACA...

CDS

Download CDS FASTA

2082 bp · LXL04_027551|LXL04_027551|OH1004|CDS

ATGAAAATGAAGAGGTCAAGGAGTGAAGTTTTTGGTTTGAGGAGGGTAAGACTGCCACACATTTTGTTTGTTGTTGCTGCATTGTATCTGATCGTTGTTTGCTTCAAGTTCTCTGCCTATTTTGAGACGTCGACCAATACTGAGAATGAAGCAGTAAGGAAATATCAGTTAGAAGTGAGTAAGCCATCGTTAGGATCTGCATCTGAGGATGGAAACAGCGAGGCATCACAAAACGACAACAGATTTGAAAAAGTGAAACA...

Protein

Download Protein FASTA

693 aa · LXL04_027551|LXL04_027551|OH1004|PROTEIN

MKMKRSRSEVFGLRRVRLPHILFVVAALYLIVVCFKFSAYFETSTNTENEAVRKYQLEVSKPSLGSASEDGNSEASQNDNRFEKVKQEKKLEDEPDANIQKRLENESKIETASQKENNEDSFPPIDLRYGRLTGDVLRRRHRTRDMTGLEKMADEAWSLGLKAWEEVHKHNEKDTKLASILEGKQEQCPPWVSMSGEELTKGDRMMFLPCGLAAGSSITVVGTPQHAHNEYVPQLAKTKPGEPLVLVSQFKVELQGLKSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027551`
TK1151 ID	TkA07G072870
OH-1004 ID	LXL04_027551
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027551

Location Chr06:18824613-18828969 (+)

Description Similar to GALT2: Hydroxyproline O-galactosyltransferase GALT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21060`	Possesses hydroxyproline O-galactosyltransferase activity.	Functional identification of a hydroxyproline-o-galactosyltransferase specific for arabinogalactan protein biosynthesis in Arabidopsis.2013 · DOI: 10.1074/jbc.m112.432609 Two Hydroxyproline Galactosyltransferases, GALT5 and GALT2, Function in Arabinogalactan-Protein Glycosylation, Growth and Development in Arabidopsis.2015 · DOI: 10.1371/journal.pone.0125624 A small multigene hydroxyproline-O-galactosyltransferase family functions in arabinogalactan-protein glycosylation, growth and development in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0670-7
`At5g62620`	Possesses hydroxyproline O-galactosyltransferase activity.	A small multigene hydroxyproline-O-galactosyltransferase family functions in arabinogalactan-protein glycosylation, growth and development in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0670-7
`At1g74800`	Possesses hydroxyproline O-galactosyltransferase activity.	Two Hydroxyproline Galactosyltransferases, GALT5 and GALT2, Function in Arabinogalactan-Protein Glycosylation, Growth and Development in Arabidopsis.2015 · DOI: 10.1371/journal.pone.0125624 A small multigene hydroxyproline-O-galactosyltransferase family functions in arabinogalactan-protein glycosylation, growth and development in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0670-7
`At1g27120`	Possesses hydroxyproline O-galactosyltransferase activity.	A small multigene hydroxyproline-O-galactosyltransferase family functions in arabinogalactan-protein glycosylation, growth and development in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0670-7
`At1g26810`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue.	A unique beta1,3-galactosyltransferase is indispensable for the biosynthesis of N-glycans containing Lewis a structures in Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.107.052985

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027551 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006493 protein O-linked glycosylation Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010405 arabinogalactan protein metabolic process Biological Process

GO:0010493 Lewis a epitope biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0080147 root hair cell development Biological Process

GO:0180062 protein O-linked glycosylation via galactose Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G26810

ath:AT1G27120

ath:AT1G74800

ath:AT4G21060

ath:AT5G62620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.824

Rank 1 · LXL04_027551 · OH-1004

Endoplasmic reticulum0.076

Rank 2 · LXL04_027551 · OH-1004

Cell membrane0.064

Rank 3 · LXL04_027551 · OH-1004

Cytoplasm0.061

Rank 4 · LXL04_027551 · OH-1004

Extracellular0.059

Rank 5 · LXL04_027551 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00337.30Gal-bind_lectin207-412 aa

PF01762.28Galactosyl_T461-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027551	`PF00337.30`	Gal-bind_lectin	207	412	1.1e-29	103.3
LXL04_027551	`PF01762.28`	Galactosyl_T	461	642	6.3e-35	121.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A7XDQ9`	Arabidopsis thaliana	Hydroxyproline O-galactosyltransferase GALT2	63.429%	Swiss-Prot	strong database homology
`Q9LV16`	Arabidopsis thaliana	Hydroxyproline O-galactosyltransferase GALT6	50.360%	Swiss-Prot	strong database homology
`Q8RX55`	Arabidopsis thaliana	Hydroxyproline O-galactosyltransferase GALT5	57.246%	Swiss-Prot	strong database homology
`Q8GXG6`	Arabidopsis thaliana	Hydroxyproline O-galactosyltransferase GALT4	57.324%	Swiss-Prot	strong database homology
`Q8L7F9`	Arabidopsis thaliana	Beta-1,3-galactosyltransferase GALT1	35.979%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card