LXL04_027372 | RubberDandelionOmics

Gene overview

LXL04_027372

Reference: OH-1004 Chr: Chr06 Coordinates: 14428511-14429965 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_027372|LXL04_027372|OH1004|cDNA

ATGGCAACCGGGAATTTCAGTTCCAAGAATATTTTAGGGCAAGGCGGATTCGGAGTGGTGTACAAGGGTATTCTCGTAAATATGACTTTAGTAGCGGTAAAAAGACTAAAAGACCCTAATTTCTCGGGTGAAGTGCAATTTCAAACCGAACTTGAGATGATAAGCTTGGCGTTACACCGCAATCTTTTACGTCTTTATGGGTTTTGTTTGACTTCGGATGAGAGATTACTAGTTTACCCCTATATGCCTAATGGAAGTGT...

CDS

Download CDS FASTA

864 bp · LXL04_027372|LXL04_027372|OH1004|CDS

ATGGCAACCGGGAATTTCAGTTCCAAGAATATTTTAGGGCAAGGCGGATTCGGAGTGGTGTACAAGGGTATTCTCGTAAATATGACTTTAGTAGCGGTAAAAAGACTAAAAGACCCTAATTTCTCGGGTGAAGTGCAATTTCAAACCGAACTTGAGATGATAAGCTTGGCGTTACACCGCAATCTTTTACGTCTTTATGGGTTTTGTTTGACTTCGGATGAGAGATTACTAGTTTACCCCTATATGCCTAATGGAAGTGT...

Protein

Download Protein FASTA

287 aa · LXL04_027372|LXL04_027372|OH1004|PROTEIN

MATGNFSSKNILGQGGFGVVYKGILVNMTLVAVKRLKDPNFSGEVQFQTELEMISLALHRNLLRLYGFCLTSDERLLVYPYMPNGSVADRLRDGGRETPLLDWSRRMHIALGAARGLVYLHEQFNPKIIHRDVKAANILLDENFEAVVGDFGLAKLLDPRDSHVTTAVRTLYEEKRLEVLIDRDLNGCYDKEELDEVVKLALVCTRAQASARLKMSEVMKVLEGITGQPGNLEDTQTGPTQQCEGGTFSFVRNCSDVCDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027372`
TK1151 ID	TkA07G053450
OH-1004 ID	LXL04_027372
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.700
Protein coverage (%)	TK1151 75.806 / OH-1004 95.122 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027372

Location Chr06:14428511-14429965 (+)

Description Similar to At5g45780: Probable LRR receptor-like serine/threonine-protein kinase At5g45780

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45780`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At2g13790`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At5g16000`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.2008 · DOI: 10.1371/journal.ppat.1000247 NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171 CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027372 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007639 homeostasis of number of meristem cells Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010150 leaf senescence Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0048653 anther development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090351 seedling development Biological Process

KEGG gene cross-reference

ath:AT1G60800

ath:AT2G13790

ath:AT3G25560

ath:AT5G45780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.558

Rank 1 · LXL04_027372 · OH-1004

Cytoplasm0.358

Rank 2 · LXL04_027372 · OH-1004

Nucleus0.246

Rank 3 · LXL04_027372 · OH-1004

Golgi apparatus0.046

Rank 4 · LXL04_027372 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_027372 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase7-170 aa

PF07714.24PK_Tyr_Ser-Thr9-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027372	`PF00069.32`	Pkinase	7	170	1.4e-28	100.7
LXL04_027372	`PF07714.24`	PK_Tyr_Ser-Thr	9	164	1.7e-30	106.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGU5`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 4	53.614%	Swiss-Prot	strong database homology
`Q93ZS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	78.107%	Swiss-Prot	moderate database homology
`Q9SKG5`	Arabidopsis thaliana	Somatic embryogenesis receptor kinase 4	50.709%	Swiss-Prot	strong database homology
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	75.148%	Swiss-Prot	moderate database homology
`Q9LFS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 5	74.118%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card