LXL04_027264 | RubberDandelionOmics

Gene overview

LXL04_027264

Reference: OH-1004 Chr: Chr06 Coordinates: 12106497-12107771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · LXL04_027264|LXL04_027264|OH1004|cDNA

ATGGCTCATGAGATTGTGGACGATGAAATTGAACAACATCTTCTCGAAAAAATCAGAAATCGCATTCAACGTAAAGGTGATCAGCAAAATCTAGTGGCTAAATACTATGCATTAGATCCTGATTTCAAAGAACTGATAACCATCCTCGAACAACCAAGAAATTCAATTCATAACGAGAATTGGTCGAGTGTAAGAAGGGAGAATCTCTATTACCTCAACAATTTGCTAAACGAATGGCAACTCACCAAAAAACGCAGCTC...

CDS

Download CDS FASTA

1275 bp · LXL04_027264|LXL04_027264|OH1004|CDS

ATGGCTCATGAGATTGTGGACGATGAAATTGAACAACATCTTCTCGAAAAAATCAGAAATCGCATTCAACGTAAAGGTGATCAGCAAAATCTAGTGGCTAAATACTATGCATTAGATCCTGATTTCAAAGAACTGATAACCATCCTCGAACAACCAAGAAATTCAATTCATAACGAGAATTGGTCGAGTGTAAGAAGGGAGAATCTCTATTACCTCAACAATTTGCTAAACGAATGGCAACTCACCAAAAAACGCAGCTC...

Protein

Download Protein FASTA

424 aa · LXL04_027264|LXL04_027264|OH1004|PROTEIN

MAHEIVDDEIEQHLLEKIRNRIQRKGDQQNLVAKYYALDPDFKELITILEQPRNSIHNENWSSVRRENLYYLNNLLNEWQLTKKRSSFSPVEDREACLNIKKSLKKMTKELKGEGGDPENSVSHHQEPEHPIFERNTKDVYRWSSRHGPRKIHGFEHNAMAMERDLVMRNINAPYKIFGIVGVAGIGKTTLCQSIFSRKLVKEHFCPRIWVCLSKQPIDHDDYRKEIVIRILHRLGVRNDVISDTGKDGDVHGLRKLILL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027264`
TK1151 ID	TkA07G043650
OH-1004 ID	LXL04_027264
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.400
Protein coverage (%)	TK1151 100.000 / OH-1004 75.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027264

Location Chr06:12106497-12107771 (+)

Description Similar to At4g19060: Probable disease resistance protein At4g19060

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19060`	Possible disease resistance protein.	No verified direct reference in this release
`At5g45490`	Possible disease resistance protein.	No verified direct reference in this release
`At5g45440`	Possible disease resistance protein.	No verified direct reference in this release
`At3g50950`	CC-NB-LRR receptor-like protein required for recognition of pathogenic bacteria type III effectors (T3E) such as Pseudomonas syringae HopZ1a and HopF2a and Xanthomonas campestris pv. campestris (Xcc) XopAC/AvrAC; this recognition requires ZED1-related kinases (e.g. PBL2, ZRK3 and ZED1/ZRK5).	Allele-specific virulence attenuation of the Pseudomonas syringae HopZ1a type III effector via the Arabidopsis ZAR1 resistance protein.2010 · DOI: 10.1371/journal.pgen.1000894

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027264 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050776 regulation of immune response Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G50950

ath:AT4G19060

ath:AT5G45440

ath:AT5G45490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.639

Rank 1 · LXL04_027264 · OH-1004

Cytoplasm0.196

Rank 2 · LXL04_027264 · OH-1004

Nucleus0.192

Rank 3 · LXL04_027264 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_027264 · OH-1004

Extracellular0.032

Rank 5 · LXL04_027264 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC175-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027264	`PF00931.29`	NB-ARC	175	285	1.8e-16	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WD3`	Arabidopsis thaliana	Probable disease resistance protein At4g19060	33.453%	Swiss-Prot	moderate database homology
`Q9FHI7`	Arabidopsis thaliana	Probable disease resistance protein At5g45490	30.451%	Swiss-Prot	moderate database homology
`Q9FHJ2`	Arabidopsis thaliana	Probable disease resistance protein At5g45440	29.730%	Swiss-Prot	weak database homology
`Q38834`	Arabidopsis thaliana	Disease resistance RPP13-like protein 4	29.297%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card