Gene Card
Gene overview
cDNA / CDS / Protein Sequences
7308 bp · LXL04_026886|LXL04_026886|OH1004|cDNA
ATGATTCCGTTGGCGCAGAGATTTTCAACCGAAATTCGGCTGTTGTTCGAGAGCTTGAACGAATCCAATTTCGACTCCGTTATTCGCGAACTCTCTCAGTATGTTGATTATGGATTGGAGGGAAGCATTCTGCTTCTAGAAACTTGCTTGGATCACTTCAAAGTTTATGAAAGAGACTTGAGGACTACTCATCTGGAACCTGTAGTTGCTTCTCTTTTTAGAAAATTACTTGAAAAGCCACAGTTTAGTACCGTATTTCA...
7308 bp · LXL04_026886|LXL04_026886|OH1004|CDS
ATGATTCCGTTGGCGCAGAGATTTTCAACCGAAATTCGGCTGTTGTTCGAGAGCTTGAACGAATCCAATTTCGACTCCGTTATTCGCGAACTCTCTCAGTATGTTGATTATGGATTGGAGGGAAGCATTCTGCTTCTAGAAACTTGCTTGGATCACTTCAAAGTTTATGAAAGAGACTTGAGGACTACTCATCTGGAACCTGTAGTTGCTTCTCTTTTTAGAAAATTACTTGAAAAGCCACAGTTTAGTACCGTATTTCA...
Protein
Download Protein FASTA2435 aa · LXL04_026886|LXL04_026886|OH1004|PROTEIN
MIPLAQRFSTEIRLLFESLNESNFDSVIRELSQYVDYGLEGSILLLETCLDHFKVYERDLRTTHLEPVVASLFRKLLEKPQFSTVFQVSVRPTSITEEFLDNLSGSLQLSSYEKLGFGLSLTDSENNDIRIAGRNFCMRQIEELCATASLHKADYVQDILLFLNKSQVLSKHVDSFMQLLSLVQFDKDSEFILAPLISDELQDSKFMKKLDFLSEGTDSEFEAILAQMEKEMNMADLMKELGYNSTSDVSLCKDLLSSFS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026886 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026886 |
|---|---|
| Location | Chr06:4708688-4722436 (-) |
| Description | Similar to cnot1: CCR4-NOT transcription complex subunit 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010606 positive regulation of cytoplasmic mRNA processing body assembly Biological Process GO:0017148 negative regulation of translation Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0048387 negative regulation of retinoic acid receptor signaling pathway Biological Process GO:0048589 developmental growth Biological Process GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process GO:0000932 P-body Cellular Component |
| KEGG gene cross-reference | dre:448949 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16418.12CNOT1_HEAT475-619 aaPF16417.12CNOT1_TTP_bind645-816 aaPF16415.12CNOT1_CAF1_bind977-1196 aaPF12842.13DUF38191330-1472 aaPF25097.2ARM_Cnot11682-1857 aaPF23590.2NOT1_connector1706-1856 aaPF04054.22Not12044-2411 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026886 | PF16418.12 | CNOT1_HEAT | 475 | 619 | 1.2e-30 | 107.3 |
| LXL04_026886 | PF16417.12 | CNOT1_TTP_bind | 645 | 816 | 1.5e-66 | 223.9 |
| LXL04_026886 | PF16415.12 | CNOT1_CAF1_bind | 977 | 1196 | 4.9e-89 | 298.2 |
| LXL04_026886 | PF12842.13 | DUF3819 | 1330 | 1472 | 6.7e-50 | 169.6 |
| LXL04_026886 | PF25097.2 | ARM_Cnot1 | 1682 | 1857 | 4.1e-54 | 184.0 |
| LXL04_026886 | PF23590.2 | NOT1_connector | 1706 | 1856 | 6.1e-19 | 69.0 |
| LXL04_026886 | PF04054.22 | Not1 | 2044 | 2411 | 3.3e-141 | 471.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.