LXL04_026609 | RubberDandelionOmics

Gene overview

LXL04_026609

Reference: OH-1004 Chr: Chr05 Coordinates: 129463362-129467876 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3642 bp · LXL04_026609|LXL04_026609|OH1004|cDNA

ATGGCTTCAAATCCTCCATTTCAGGTGGAGGATACTGATGAAGATTTCTTTGATAAATTGgtcaatgatgatgatgatgattataAGTTGGGTCCATTATCCTCAGAGACGACCAAAATAGCTGATGGGAACGATTCTGATGATGCTAAAGCTTTTGCTAATTTAGGTATCAGTGATGTTGCAACTGTACTTGAAGATTTGGGGAAAGTAGGTGcaggggaagaagaagaagcgaTTAATGGGGATGCCAAGCATACGTC...

CDS

Download CDS FASTA

3642 bp · LXL04_026609|LXL04_026609|OH1004|CDS

ATGGCTTCAAATCCTCCATTTCAGGTGGAGGATACTGATGAAGATTTCTTTGATAAATTGGTCAATGATGATGATGATGATTATAAGTTGGGTCCATTATCCTCAGAGACGACCAAAATAGCTGATGGGAACGATTCTGATGATGCTAAAGCTTTTGCTAATTTAGGTATCAGTGATGTTGCAACTGTACTTGAAGATTTGGGGAAAGTAGGTGCAGGGGAAGAAGAAGAAGCGATTAATGGGGATGCCAAGCATACGTC...

Protein

Download Protein FASTA

1213 aa · LXL04_026609|LXL04_026609|OH1004|PROTEIN

MASNPPFQVEDTDEDFFDKLVNDDDDDYKLGPLSSETTKIADGNDSDDAKAFANLGISDVATVLEDLGKVGAGEEEEAINGDAKHTSTDHGHLLATSKSFAFDSVSEEPNIEVAALEDYRGSLDDGCGGVTVKEVQWTAFGAEAVESEGNGFGSYNDFFTEIGDSCADEIVGKGGKLVSEEQKVVSDVVDDSISMHRKNVDEFQDLQTYGEQSRDGSQDPNSNWEDLYPGWKYDADSGQWYQVNESYENVDDLSNKAEVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026609`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026609

Location Chr05:129463362-129467876 (+)

Description Similar to SEC16B: Protein transport protein SEC16B homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47490`	Required for protein transport from the endoplasmic reticulum to the Golgi apparatus.	No verified direct reference in this release
`At5g47480`	Required for efficient protein export from the endoplasmic reticulum (ER) to the Golgi by regulating COPII coat dynamics at the ER.	MAIGO5 functions in protein export from Golgi-associated endoplasmic reticulum exit sites in Arabidopsis.2013 · DOI: 10.1105/tpc.113.118158

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026609 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0015031 protein transport Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0070863 positive regulation of protein exit from endoplasmic reticulum Biological Process

GO:0070973 protein localization to endoplasmic reticulum exit site Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT5G47480

ath:AT5G47490

gga:424431

mmu:89867

rno:89868

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.359

Rank 1 · LXL04_026609 · OH-1004

Cytoplasm0.333

Rank 2 · LXL04_026609 · OH-1004

Endoplasmic reticulum0.240

Rank 3 · LXL04_026609 · OH-1004

Nucleus0.226

Rank 4 · LXL04_026609 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_026609 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12932.13Sec16467-567 aa

PF12931.14TPR_Sec16626-878 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026609	`PF12932.13`	Sec16	467	567	1.1e-12	49.2
LXL04_026609	`PF12931.14`	TPR_Sec16	626	878	3.9e-53	181.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGK8`	Arabidopsis thaliana	Protein transport protein SEC16B homolog	44.043%	Swiss-Prot	moderate database homology
`Q9FGK9`	Arabidopsis thaliana	Protein transport protein SEC16A homolog	44.496%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card