LXL04_026145 | RubberDandelionOmics

Gene overview

LXL04_026145

Reference: OH-1004 Chr: Chr05 Coordinates: 121760840-121763838 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2142 bp · LXL04_026145|LXL04_026145|OH1004|cDNA

ATGGCTGATTCTGTCGATACTTTGGCTTCGCCCTCTGAATCAGTTACTAAATACTCAGATACGGTTGAATCGTTTTGGCCAAAGGATTCTCGTTCGCCTACACAAACCCTAGATCGACAGTCGAGCTCTCCGGATACTAAGGTCGATGCTCACGTTAGCGTGTTTGATCAATTATTACGCGAAGAGGAGGAAAAATTGGAGGATTTTAAGACAACAGAGTCGCAAGTGAATCCTATTATGTCCGCTGAAGCGCTCGAAGA...

CDS

Download CDS FASTA

2142 bp · LXL04_026145|LXL04_026145|OH1004|CDS

ATGGCTGATTCTGTCGATACTTTGGCTTCGCCCTCTGAATCAGTTACTAAATACTCAGATACGGTTGAATCGTTTTGGCCAAAGGATTCTCGTTCGCCTACACAAACCCTAGATCGACAGTCGAGCTCTCCGGATACTAAGGTCGATGCTCACGTTAGCGTGTTTGATCAATTATTACGCGAAGAGGAGGAAAAATTGGAGGATTTTAAGACAACAGAGTCGCAAGTGAATCCTATTATGTCCGCTGAAGCGCTCGAAGA...

Protein

Download Protein FASTA

713 aa · LXL04_026145|LXL04_026145|OH1004|PROTEIN

MADSVDTLASPSESVTKYSDTVESFWPKDSRSPTQTLDRQSSSPDTKVDAHVSVFDQLLREEEEKLEDFKTTESQVNPIMSAEALEDSEEPALSLSGAEANAPTEPSSPVDVDDNANSLADETDAWISCNRSENDVYKPMPSVPSSSSSWYEDAYEKPYMVGAGLANLGNTCFFNAVMQCFTHSVLLVQGLYSYTFPTPCDCNNERFCLICALREQIELSLTSTGKVVSPWKFVDNLSYFSSSFQRYQQEDAHEFLQCFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026145`
TK1151 ID	TkA06G024910
OH-1004 ID	LXL04_026145
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 88.421 / OH-1004 58.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026145

Location Chr05:121760840-121763838 (-)

Description Similar to UBP21: Ubiquitin carboxyl-terminal hydrolase 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46740`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At4g17895`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At5g57990`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026145 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17895

ath:AT5G46740

ath:AT5G57990

hsa:84132

rno:288482

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · LXL04_026145 · OH-1004

Cytoplasm0.304

Rank 2 · LXL04_026145 · OH-1004

Mitochondrion0.040

Rank 3 · LXL04_026145 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_026145 · OH-1004

Endoplasmic reticulum0.018

Rank 5 · LXL04_026145 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443.36UCH163-470 aa

PF13423.13UCH_1163-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026145	`PF00443.36`	UCH	163	470	4.5e-62	210.7
LXL04_026145	`PF13423.13`	UCH_1	163	452	9.4e-25	88.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIQ1`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 21	49.754%	Swiss-Prot	moderate database homology
`Q9FPS7`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 20	52.446%	Swiss-Prot	moderate database homology
`Q9FPS4`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 23	36.859%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card