LXL04_025977 | RubberDandelionOmics

Gene overview

LXL04_025977

Reference: OH-1004 Chr: Chr05 Coordinates: 119324215-119325766 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_025977|LXL04_025977|OH1004|cDNA

ATGGAAAACAATGGGTTTAATATCCCGATGGGTATGGCCGGCGTCGGAGAGGGGTTCATCGTTCCCGATGAAAACTTTCAGAAGCCTTTCGTTTATCAAAACCACCACCATATGATGCCGGGATTTCAGGAGATTACGAATCCGACGGACAATTTTCCGTCGATTGGGAACATGGATATTCCGATTTCCGCCACCGCTCTCGCGGCTCTTCTCGCGTCCAGACATGGTCAACACGAGAGCTTGAATTTACCGCCTTTTGG...

CDS

Download CDS FASTA

1317 bp · LXL04_025977|LXL04_025977|OH1004|CDS

ATGGAAAACAATGGGTTTAATATCCCGATGGGTATGGCCGGCGTCGGAGAGGGGTTCATCGTTCCCGATGAAAACTTTCAGAAGCCTTTCGTTTATCAAAACCACCACCATATGATGCCGGGATTTCAGGAGATTACGAATCCGACGGACAATTTTCCGTCGATTGGGAACATGGATATTCCGATTTCCGCCACCGCTCTCGCGGCTCTTCTCGCGTCCAGACATGGTCAACACGAGAGCTTGAATTTACCGCCTTTTGG...

Protein

Download Protein FASTA

438 aa · LXL04_025977|LXL04_025977|OH1004|PROTEIN

MENNGFNIPMGMAGVGEGFIVPDENFQKPFVYQNHHHMMPGFQEITNPTDNFPSIGNMDIPISATALAALLASRHGQHESLNLPPFGQPFDVPKSVNCFPSSFNASDNFGYAGMLTPPANRWISAENNSNPLDGNELSLSLATCSGMSSLSLHGRQLGSLEQASSCNSRSLSLGFDSNSNSISITNRPIQVLQCSSGSTGYLHTMQEILTEIATYSLGNLDQISYYKQISPDGNNNFDLKVRGVEAKKKHLLALLEMVDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025977`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025977

Location Chr05:119324215-119325766 (-)

Description Similar to ATH1: Homeobox protein ATH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32980`	Transcription factor which may be involved in the signal transduction pathway downstream of the COP1 gene.	No verified direct reference in this release
`At2g27220`	BEL1-like homeodomain protein 5.	No verified direct reference in this release
`At2g16400`	BEL1-like homeodomain protein 7.	No verified direct reference in this release
`At1g19700`	BEL1-like homeodomain protein 10.	No verified direct reference in this release
`At4g34610`	BEL1-like homeodomain protein 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025977 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010371 regulation of gibberellin biosynthetic process Biological Process

GO:0090470 shoot organ boundary specification Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G19700

ath:AT2G16400

ath:AT2G27220

ath:AT4G32980

ath:AT4G34610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · LXL04_025977 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_025977 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_025977 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_025977 · OH-1004

Plastid0.017

Rank 5 · LXL04_025977 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07526.17POX200-307 aa

PF05920.18Homeobox_KN364-403 aa

PF00046.36Homeodomain366-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025977	`PF07526.17`	POX	200	307	1.1e-21	78.5
LXL04_025977	`PF05920.18`	Homeobox_KN	364	403	9.6e-18	64.5
LXL04_025977	`PF00046.36`	Homeodomain	366	403	2.1e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48731`	Arabidopsis thaliana	Homeobox protein ATH1	52.922%	Swiss-Prot	moderate database homology
`Q8S897`	Arabidopsis thaliana	BEL1-like homeodomain protein 5	37.302%	Swiss-Prot	moderate database homology
`Q9SIW1`	Arabidopsis thaliana	BEL1-like homeodomain protein 7	38.017%	Swiss-Prot	weak database homology
`Q9FXG8`	Arabidopsis thaliana	BEL1-like homeodomain protein 10	32.092%	Swiss-Prot	moderate database homology
`O65685`	Arabidopsis thaliana	BEL1-like homeodomain protein 6	43.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card