LXL04_025862 | RubberDandelionOmics

Gene overview

LXL04_025862

Reference: OH-1004 Chr: Chr05 Coordinates: 117834700-117838471 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · LXL04_025862|LXL04_025862|OH1004|cDNA

ATGGAAGAGATAATGTCAGAGACACGATCGCCGATGCCATTGTTGTATAGACGACATTCAAGCGGGGAGGTGATGAAAAACTTAGCTTCTGTCTCGAGCAGTCTCTTGCCTGCTTTTGGAACTCTGGTCGGCGATGATTCTCCTCCTCTTAAGAAATATGTCATTGCACCTTATGATCGTAGGTATCGGTGGTGGCAAGCATTTTTGGTTGTATTAGTCATCTACTCGGCATGGTCATCACCTTTCGAGTTAGCTTTCAA...

CDS

Download CDS FASTA

1866 bp · LXL04_025862|LXL04_025862|OH1004|CDS

ATGGAAGAGATAATGTCAGAGACACGATCGCCGATGCCATTGTTGTATAGACGACATTCAAGCGGGGAGGTGATGAAAAACTTAGCTTCTGTCTCGAGCAGTCTCTTGCCTGCTTTTGGAACTCTGGTCGGCGATGATTCTCCTCCTCTTAAGAAATATGTCATTGCACCTTATGATCGTAGGTATCGGTGGTGGCAAGCATTTTTGGTTGTATTAGTCATCTACTCGGCATGGTCATCACCTTTCGAGTTAGCTTTCAA...

Protein

Download Protein FASTA

621 aa · LXL04_025862|LXL04_025862|OH1004|PROTEIN

MEEIMSETRSPMPLLYRRHSSGEVMKNLASVSSSLLPAFGTLVGDDSPPLKKYVIAPYDRRYRWWQAFLVVLVIYSAWSSPFELAFKDVATSSLMFLDLVVDLFFAIDIILTFFVAYLDKSTYLLVDDHKKIAIRYVTHMMFLMDVASTMPFQSLYRLFTGKLHRGQAFGFLNLLRLWRLRRVSDLFSRLEKDTRFSYFLTRCTKLICVTLFAVHSAGCFYYWIATHHSPSEKTWIGSIIQDFEDRSIWLGYTYALYWSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025862`
TK1151 ID	TkA06G032680
OH-1004 ID	LXL04_025862
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025862

Location Chr05:117834700-117838471 (-)

Description Similar to KAT3: Potassium channel KAT3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32650`	Probable modulatory (alpha) subunit of inward-rectifying potassium channels.	No verified direct reference in this release
`At5g46240`	Highly selective inward-rectifying potassium channel.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0718700`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os06g0254200`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os01g0648000`	Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.	Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025862 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0034702 monoatomic ion channel complex Cellular Component

GO:0005242 inward rectifier potassium channel activity Molecular Function

GO:0005249 voltage-gated potassium channel activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT4G32650

ath:AT5G46240

dosa:Os01g0648000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.565

Rank 1 · LXL04_025862 · OH-1004

Cytoplasm0.179

Rank 2 · LXL04_025862 · OH-1004

Endoplasmic reticulum0.142

Rank 3 · LXL04_025862 · OH-1004

Lysosome / Vacuole0.132

Rank 4 · LXL04_025862 · OH-1004

Golgi apparatus0.090

Rank 5 · LXL04_025862 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans62-307 aa

PF07885.23Ion_trans_2237-304 aa

PF00027.36cNMP_binding396-478 aa

PF11834.14KHA552-620 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025862	`PF00520.38`	Ion_trans	62	307	2.5e-39	135.6
LXL04_025862	`PF07885.23`	Ion_trans_2	237	304	1.6e-13	51.0
LXL04_025862	`PF00027.36`	cNMP_binding	396	478	9.2e-16	58.3
LXL04_025862	`PF11834.14`	KHA	552	620	4.9e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92960`	Arabidopsis thaliana	Potassium channel KAT3	56.542%	Swiss-Prot	strong database homology
`Q39128`	Arabidopsis thaliana	Potassium channel KAT1	42.337%	Swiss-Prot	moderate database homology
`A2ZX97`	Oryza sativa subsp. japonica	Potassium channel KAT6	50.656%	Swiss-Prot	strong database homology
`Q652U9`	Oryza sativa subsp. japonica	Potassium channel KAT4	49.167%	Swiss-Prot	moderate database homology
`Q0JKV1`	Oryza sativa subsp. japonica	Potassium channel AKT1	51.767%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card