LXL04_025758 | RubberDandelionOmics

Gene overview

LXL04_025758

Reference: OH-1004 Chr: Chr05 Coordinates: 116657153-116658479 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · LXL04_025758|LXL04_025758|OH1004|cDNA

ATGTTCCGGCAGCTTATCGGTCAACTTCAAGACTTCGTAGATCTCCATGGTTTTCCTCCTCCACCGGCTCCAATTGCTCCGCCGTCATATTTCTTTCATCCTCAACCTCCGACGAAACTTCCACCGCCACCGCCGTCGCCTCTTCATGACGACAGGAAATCAAAGAGAACTCAAAAAGAGCCAACACAAATCGAAACTTCTGATTTAAACGAGACCATGGAAGAGATCTGGAGGTATTTTCCCGAAGACCTATACGAGGC...

CDS

Download CDS FASTA

1263 bp · LXL04_025758|LXL04_025758|OH1004|CDS

ATGTTCCGGCAGCTTATCGGTCAACTTCAAGACTTCGTAGATCTCCATGGTTTTCCTCCTCCACCGGCTCCAATTGCTCCGCCGTCATATTTCTTTCATCCTCAACCTCCGACGAAACTTCCACCGCCACCGCCGTCGCCTCTTCATGACGACAGGAAATCAAAGAGAACTCAAAAAGAGCCAACACAAATCGAAACTTCTGATTTAAACGAGACCATGGAAGAGATCTGGAGGTATTTTCCCGAAGACCTATACGAGGC...

Protein

Download Protein FASTA

420 aa · LXL04_025758|LXL04_025758|OH1004|PROTEIN

MFRQLIGQLQDFVDLHGFPPPPAPIAPPSYFFHPQPPTKLPPPPPSPLHDDRKSKRTQKEPTQIETSDLNETMEEIWRYFPEDLYEAVIARLPIAAFFRFRSVCHNWNSLLTSDGFTRQCSQFRPPQPWFYTIAHNNVNSGAMYDPVSRKWHHPIAPKIPTTTIVFPVASAGGLLCFLDIGHRSFYVCNPLTNSIKELPTRSAKVWQRVAVGMMSETPATGTGGYKIMWLASNGEYEVYNSKTDTWQRLGTMPECIKLPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025758`
TK1151 ID	TkA03G120360
OH-1004 ID	LXL04_025758
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025758

Location Chr05:116657153-116658479 (-)

Description Similar to FBX6: F-box only protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27340`	F-box only protein 6.	No verified direct reference in this release
`At1g30950`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At4g33160`	F-box only protein 13.	No verified direct reference in this release
`At5g15710`	F-box/kelch-repeat protein At5g15710.	No verified direct reference in this release
`At3g61590`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025758 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009908 flower development Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process

GO:0060776 simple leaf morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G27340

ath:AT1G30950

ath:AT3G61590

ath:AT4G33160

ath:AT5G15710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.535

Rank 1 · LXL04_025758 · OH-1004

Cytoplasm0.386

Rank 2 · LXL04_025758 · OH-1004

Cell membrane0.133

Rank 3 · LXL04_025758 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_025758 · OH-1004

Plastid0.047

Rank 5 · LXL04_025758 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box80-118 aa

PF24750.2b-prop_At3g26010-like165-345 aa

PF03478.25Beta-prop_KIB1-4167-354 aa

PF07734.19FBA_1168-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025758	`PF00646.39`	F-box	80	118	1.4e-06	28.7
LXL04_025758	`PF24750.2`	b-prop_At3g26010-like	165	345	2.1e-08	34.4
LXL04_025758	`PF03478.25`	Beta-prop_KIB1-4	167	354	5.2e-10	40.0
LXL04_025758	`PF07734.19`	FBA_1	168	379	5.8e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZK1`	Arabidopsis thaliana	F-box only protein 6	56.464%	Swiss-Prot	strong database homology
`Q39090`	Arabidopsis thaliana	Protein UNUSUAL FLORAL ORGANS	25.779%	Swiss-Prot	weak database homology
`Q9SMZ3`	Arabidopsis thaliana	F-box only protein 13	25.815%	Swiss-Prot	weak database homology
`Q9LFV5`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g15710	28.814%	Swiss-Prot	weak database homology
`Q9M310`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g61590	33.775%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card