Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2670 bp · LXL04_025674|LXL04_025674|OH1004|cDNA
CTGCTCCGCCTCTGCTCCATTTTCGCTTTTGCCGTTATCGCTTGCCCCGGTATCTGTTTGGTTCTTTCTGCTGTGGGCGTCGTCTCCTCGTGTGACGACACAGGTCAGATAATGGAACCATCATCAGTTGAAGGAAAACCTTCAACACCATCAACTCCAACTACTGCACCTGCTTCAAGTGTCAGTACACTTACTCTAAAAGATGAAGACACTGTCAGCACTACAATGATAAATTCACCAGGTTCTTTACCATTTCCAAG...
2670 bp · LXL04_025674|LXL04_025674|OH1004|CDS
CTGCTCCGCCTCTGCTCCATTTTCGCTTTTGCCGTTATCGCTTGCCCCGGTATCTGTTTGGTTCTTTCTGCTGTGGGCGTCGTCTCCTCGTGTGACGACACAGGTCAGATAATGGAACCATCATCAGTTGAAGGAAAACCTTCAACACCATCAACTCCAACTACTGCACCTGCTTCAAGTGTCAGTACACTTACTCTAAAAGATGAAGACACTGTCAGCACTACAATGATAAATTCACCAGGTTCTTTACCATTTCCAAG...
Protein
Download Protein FASTA889 aa · LXL04_025674|LXL04_025674|OH1004|PROTEIN
MLRLCSIFAFAVIACPGICLVLSAVGVVSSCDDTGQIMEPSSVEGKPSTPSTPTTAPASSVSTLTLKDEDTVSTTMINSPGSLPFPRPSVPGISSTSGPSFSYNIPQVMPPPSPVAIPRDTSSNAANFSYNGHHQSAPPVSHSAPQHTVGPTFWMPSGPPFQPPAGRAATLPPPPTTTVASSQQPVYGPYGTNPLMAAPPQGVWLQPAPIGGLSRPSVLPYPPSFPGSFPMPAQFMPPPSDAQPPGTSVGVPGSMLLELP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025674 |
|---|---|
| TK1151 ID | TkA06G046170 |
| OH-1004 ID | LXL04_025674 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 95.838Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025674 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:115074360-115078702 (-) | |||||||||
| Description | Similar to PRP40C: Pre-mRNA-processing protein 40C | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0003711 transcription elongation factor activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G19840 hsa:10915 mmu:56070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00397.33WW287-313 aaPF23517.2WW_TCERG1327-370 aaPF00397.33WW338-365 aaPF01846.26FF503-549 aaPF01846.26FF568-616 aaPF01846.26FF639-684 aaPF01846.26FF738-790 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025674 | PF00397.33 | WW | 287 | 313 | 9.7e-15 | 55.0 |
| LXL04_025674 | PF23517.2 | WW_TCERG1 | 327 | 370 | 1.2e-07 | 31.6 |
| LXL04_025674 | PF00397.33 | WW | 338 | 365 | 9.7e-15 | 55.0 |
| LXL04_025674 | PF01846.26 | FF | 503 | 549 | 1.5e-46 | 157.0 |
| LXL04_025674 | PF01846.26 | FF | 568 | 616 | 1.5e-46 | 157.0 |
| LXL04_025674 | PF01846.26 | FF | 639 | 684 | 1.5e-46 | 157.0 |
| LXL04_025674 | PF01846.26 | FF | 738 | 790 | 1.5e-46 | 157.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.