LXL04_025304 | RubberDandelionOmics

Gene overview

LXL04_025304

Reference: OH-1004 Chr: Chr05 Coordinates: 109485814-109487217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · LXL04_025304|LXL04_025304|OH1004|cDNA

ATGGCAGACTGGTCTCAACTTCCGAGAGAGCTTCTTGATCTCATTTCCAAACACCTCAACTCGGAGACCGATCTTGTCCGTTTCCGATCTGTTTGCACCTCCTGGCGATCCTCCATACAAACTTTCACTTCCCGTTTTCCGATTCTCCCAAACACCGGAATCTCGGATTCGAACTGGGGTTTCTACCTCTCCAAACGGACCATCTTTCGTGTCGAATTACCTGATCCTGATTCACAGCAAACCCGCCTTCCATGGCTAAT...

CDS

Download CDS FASTA

1203 bp · LXL04_025304|LXL04_025304|OH1004|CDS

ATGGCAGACTGGTCTCAACTTCCGAGAGAGCTTCTTGATCTCATTTCCAAACACCTCAACTCGGAGACCGATCTTGTCCGTTTCCGATCTGTTTGCACCTCCTGGCGATCCTCCATACAAACTTTCACTTCCCGTTTTCCGATTCTCCCAAACACCGGAATCTCGGATTCGAACTGGGGTTTCTACCTCTCCAAACGGACCATCTTTCGTGTCGAATTACCTGATCCTGATTCACAGCAAACCCGCCTTCCATGGCTAAT...

Protein

Download Protein FASTA

400 aa · LXL04_025304|LXL04_025304|OH1004|PROTEIN

MADWSQLPRELLDLISKHLNSETDLVRFRSVCTSWRSSIQTFTSRFPILPNTGISDSNWGFYLSKRTIFRVELPDPDSQQTRLPWLIKVEKDNPQKTHLMNPLSGSEFISLLPNFPRSLDLLNFRVTELGQEYALQYISYRPNANSIGDSVTLYMEKVAFCSSGVDGFVLLTIHTSGRLAMLRNGERRWNIINDLPSPYDDVIFYKGEFYAVDITGRTVVLVMDSETTLKVVANSVFGGDKKFLLESDGELFMVDKFLSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025304`
TK1151 ID	TkA06G068690
OH-1004 ID	LXL04_025304
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025304

Location Chr05:109485814-109487217 (+)

Description Similar to SKIP23: F-box protein SKIP23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17030`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g17036`	F-box protein At2g17036.	No verified direct reference in this release
`At1g65770`	Putative F-box protein At1g65770.	No verified direct reference in this release
`At5g60060`	Putative F-box protein At5g60060.	No verified direct reference in this release
`At3g25750`	Putative F-box protein At3g25750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025304 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:2000083 negative regulation of L-ascorbic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G65770

ath:AT2G17030

ath:AT2G17036

ath:AT3G25750

ath:AT5G60060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.554

Rank 1 · LXL04_025304 · OH-1004

Cytoplasm0.523

Rank 2 · LXL04_025304 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_025304 · OH-1004

Endoplasmic reticulum0.073

Rank 4 · LXL04_025304 · OH-1004

Plastid0.030

Rank 5 · LXL04_025304 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box4-42 aa

PF12937.13F-box-like4-39 aa

PF03478.25Beta-prop_KIB1-461-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025304	`PF00646.39`	F-box	4	42	4e-07	30.4
LXL04_025304	`PF12937.13`	F-box-like	4	39	1.8e-06	28.3
LXL04_025304	`PF03478.25`	Beta-prop_KIB1-4	61	358	5.8e-52	177.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EBZ2`	Arabidopsis thaliana	F-box protein SKIP23	47.631%	Swiss-Prot	moderate database homology
`Q6DR20`	Arabidopsis thaliana	F-box protein At2g17036	38.049%	Swiss-Prot	moderate database homology
`Q9SHX9`	Arabidopsis thaliana	Putative F-box protein At1g65770	32.190%	Swiss-Prot	moderate database homology
`Q9LVG8`	Arabidopsis thaliana	Putative F-box protein At5g60060	31.884%	Swiss-Prot	moderate database homology
`Q9LS04`	Arabidopsis thaliana	Putative F-box protein At3g25750	26.316%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card