LXL04_024867 | RubberDandelionOmics

Gene overview

LXL04_024867

Reference: OH-1004 Chr: Chr05 Coordinates: 101061791-101063159 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · LXL04_024867|LXL04_024867|OH1004|cDNA

ATGGGCTTGTGGGATTCTTTACTCAATTGGCTTCGCAGTGCTTTACGATTCTTACCATGTTTAGATATCAGTTTGTTCTTTAAACAGGAAATGGAGCTTTCCCTAGTAGGCCTTCAAGATGCTGGAAAGACATCTCTCGTGAATTCCATTGCTACAGGCGGCTATAGCGAGGACATGATTCCAACTGTTGGATTTAATATGCGAAAAGTCACTAAAGGAAATGTCACAATTAAGCTTTGGGATCTTGGAGGACAACGGAG...

CDS

Download CDS FASTA

588 bp · LXL04_024867|LXL04_024867|OH1004|CDS

ATGGGCTTGTGGGATTCTTTACTCAATTGGCTTCGCAGTGCTTTACGATTCTTACCATGTTTAGATATCAGTTTGTTCTTTAAACAGGAAATGGAGCTTTCCCTAGTAGGCCTTCAAGATGCTGGAAAGACATCTCTCGTGAATTCCATTGCTACAGGCGGCTATAGCGAGGACATGATTCCAACTGTTGGATTTAATATGCGAAAAGTCACTAAAGGAAATGTCACAATTAAGCTTTGGGATCTTGGAGGACAACGGAG...

Protein

Download Protein FASTA

195 aa · LXL04_024867|LXL04_024867|OH1004|PROTEIN

MGLWDSLLNWLRSALRFLPCLDISLFFKQEMELSLVGLQDAGKTSLVNSIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQRRFRTMWERYCRGVTAILYVVDAADRDSIPITKTELHDLLTKPSLNGIPLLVLGNKIDKSQALTKQALVDQLGLDTITDREVCCYMISCKESINIDMVIDWLIKHSKTAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024867`
TK1151 ID	TkA06G099450
OH-1004 ID	LXL04_024867
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024867

Location Chr05:101061791-101063159 (-)

Description Similar to ARL8C: ADP-ribosylation factor-like protein 8c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37680`	May play a role in lysosome motility.	No verified direct reference in this release
`At5g67560`	May play a role in lysosome motility.	No verified direct reference in this release
`At3g49870`	May play a role in lysosome motility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024867 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002505 antigen processing and presentation of polysaccharide antigen via MHC class II Biological Process

GO:0002747 antigen processing and presentation following phagocytosis Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0015031 protein transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0032418 lysosome localization Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0034498 early endosome to Golgi transport Biological Process

GO:0046754 viral exocytosis Biological Process

GO:0051301 cell division Biological Process

GO:0051607 defense response to virus Biological Process

GO:0061909 autophagosome-lysosome fusion Biological Process

KEGG gene cross-reference

ath:AT3G49870

ath:AT5G37680

ath:AT5G67560

mmu:67166

rno:500282

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.322

Rank 1 · LXL04_024867 · OH-1004

Golgi apparatus0.301

Rank 2 · LXL04_024867 · OH-1004

Endoplasmic reticulum0.272

Rank 3 · LXL04_024867 · OH-1004

Cell membrane0.172

Rank 4 · LXL04_024867 · OH-1004

Lysosome / Vacuole0.140

Rank 5 · LXL04_024867 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf28-189 aa

PF09439.17SRPRB33-157 aa

PF00071.29Ras34-190 aa

PF08477.20Roc34-143 aa

PF01926.30MMR_HSR134-141 aa

PF04670.19Gtr1_RagA35-156 aa

PF00503.27G-alpha60-113 aa

PF00009.34GTP_EFTU66-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024867	`PF00025.28`	Arf	28	189	2.6e-43	148.2
LXL04_024867	`PF09439.17`	SRPRB	33	157	6.3e-08	32.9
LXL04_024867	`PF00071.29`	Ras	34	190	1.7e-18	67.4
LXL04_024867	`PF08477.20`	Roc	34	143	7.4e-16	59.2
LXL04_024867	`PF01926.30`	MMR_HSR1	34	141	3.4e-06	27.9
LXL04_024867	`PF04670.19`	Gtr1_RagA	35	156	2.8e-08	34.2
LXL04_024867	`PF00503.27`	G-alpha	60	113	7.8e-08	32.5
LXL04_024867	`PF00009.34`	GTP_EFTU	66	191	1.1e-06	29.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4C8`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8c	84.103%	Swiss-Prot	strong database homology
`Q93Y31`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8b	74.872%	Swiss-Prot	strong database homology
`Q8VY57`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8a	74.611%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card