LXL04_024615 | RubberDandelionOmics

Gene overview

LXL04_024615

Reference: OH-1004 Chr: Chr05 Coordinates: 95225003-95226250 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · LXL04_024615|LXL04_024615|OH1004|cDNA

GACTGGTTTTAACAAAAAGATTCATCGTTTCTAATGATGAACACAGATATGGCAACATATGTCGAGCCTCCAAACGGATTCAGGCAAATAGGGAAGCATTATTACACTATGTGGCAACAATTGTTTGAAATCGATACAAAATATATTCCGATCAAACCAATCGGCAGGGGAGCGTACGGTGTTGTTTGTTCTTCGATCAACAGAGAAACAAACGAGAAAGTTGCAATCAAGAAGATCAACAATGTGTTTGGAAATCCTAC...

CDS

Download CDS FASTA

1131 bp · LXL04_024615|LXL04_024615|OH1004|CDS

ATGATGAACACAGATATGGCAACATATGTCGAGCCTCCAAACGGATTCAGGCAAATAGGGAAGCATTATTACACTATGTGGCAACAATTGTTTGAAATCGATACAAAATATATTCCGATCAAACCAATCGGCAGGGGAGCGTACGGTGTTGTTTGTTCTTCGATCAACAGAGAAACAAACGAGAAAGTTGCAATCAAGAAGATCAACAATGTGTTTGGAAATCCTACTGACGCGTTAAGAACACTAAGAGAATTGAAGCT...

Protein

Download Protein FASTA

376 aa · LXL04_024615|LXL04_024615|OH1004|PROTEIN

MMNTDMATYVEPPNGFRQIGKHYYTMWQQLFEIDTKYIPIKPIGRGAYGVVCSSINRETNEKVAIKKINNVFGNPTDALRTLRELKLLRHIRHENVIGLKDVMFPIYRNSFKDVYLVYELMDTDLHHIIKSSQPLSNDHCKFFLFQLLRGLKYLHSANVLHRDLKPGNLLVNANCELKICDFGLARTSQGSEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPLFPGTECLNQLKLIINILGSQNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024615`
TK1151 ID	TkA06G124510
OH-1004 ID	LXL04_024615
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.670 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024615

Location Chr05:95225003-95226250 (+)

Description Similar to MPK7: Mitogen-activated protein kinase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18170`	MKK3-MPK7 module acts as a positive regulator of PR1 gene expression.	The Arabidopsis mitogen-activated protein kinase kinase MKK3 is upstream of group C mitogen-activated protein kinases and participates in pathogen signaling.2007 · DOI: 10.1105/tpc.106.050039

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0699400`	Mitogen-activated protein kinase 4.	No verified direct reference in this release
`Os02g0148100`	Mitogen-activated protein kinase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024615 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18170

dosa:Os02g0148100

dosa:Os06g0699400

osa:4328297

osa:4341956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.622

Rank 1 · LXL04_024615 · OH-1004

Nucleus0.556

Rank 2 · LXL04_024615 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_024615 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_024615 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_024615 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase40-324 aa

PF07714.24PK_Tyr_Ser-Thr41-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024615	`PF00069.32`	Pkinase	40	324	1.6e-68	231.7
LXL04_024615	`PF07714.24`	PK_Tyr_Ser-Thr	41	234	1.6e-30	107.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39027`	Arabidopsis thaliana	Mitogen-activated protein kinase 7	82.645%	Swiss-Prot	strong database homology
`Q5Z859`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 4	78.846%	Swiss-Prot	strong database homology
`Q6Z437`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 3	76.567%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card