LXL04_024160 | RubberDandelionOmics

Gene overview

LXL04_024160

Reference: OH-1004 Chr: Chr05 Coordinates: 82939853-82941320 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · LXL04_024160|LXL04_024160|OH1004|cDNA

ATGGCAAAACCCCATGTTCTCGTCATACCTTATCCCGCACAAGGCCATGTAATCCCTATAATGGAGCTTGCTCTACGATTAGTCAATCATGGTGTCAAAGTTACATTTGTAAACACAGAAGTCAATCACCAGCTTGTGACAAGCAACTCGTTAGTAACCGATGGTTCTAAGGATTTAATGCAGTTGGTTGCAATCCCTGACGGGTTAGAACCATGGGAGGACAGGAGCAACCTTTGTATGTTGACCAATTCAATATTACA...

CDS

Download CDS FASTA

1383 bp · LXL04_024160|LXL04_024160|OH1004|CDS

ATGGCAAAACCCCATGTTCTCGTCATACCTTATCCCGCACAAGGCCATGTAATCCCTATAATGGAGCTTGCTCTACGATTAGTCAATCATGGTGTCAAAGTTACATTTGTAAACACAGAAGTCAATCACCAGCTTGTGACAAGCAACTCGTTAGTAACCGATGGTTCTAAGGATTTAATGCAGTTGGTTGCAATCCCTGACGGGTTAGAACCATGGGAGGACAGGAGCAACCTTTGTATGTTGACCAATTCAATATTACA...

Protein

Download Protein FASTA

460 aa · LXL04_024160|LXL04_024160|OH1004|PROTEIN

MAKPHVLVIPYPAQGHVIPIMELALRLVNHGVKVTFVNTEVNHQLVTSNSLVTDGSKDLMQLVAIPDGLEPWEDRSNLCMLTNSILQTMPHKLEMLIETINKEDSNKVTCIIADDGMGWAIKVAKKMGIARAAFWPASVASLACIMSFQRLIDDGIIDNNGIPIIHQMIQLSETMPPFNSTNQLPWTCFEDLGTVKAFFQVVVEGVEAASLTEWFICNSSTELEPGALSLYPQLLPIGPLLASSRLGDQSGHFWQEDSTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024160`
TK1151 ID	TkA06G171040
OH-1004 ID	LXL04_024160
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 94.781 / OH-1004 98.696 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024160

Location Chr05:82939853-82941320 (-)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024160 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050057 linamarin synthase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:ABV68925

ag:AEO45781

ag:AEO45782

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.710

Rank 1 · LXL04_024160 · OH-1004

Nucleus0.181

Rank 2 · LXL04_024160 · OH-1004

Endoplasmic reticulum0.080

Rank 3 · LXL04_024160 · OH-1004

Plastid0.075

Rank 4 · LXL04_024160 · OH-1004

Peroxisome0.073

Rank 5 · LXL04_024160 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT271-428 aa

PF06722.19EryCIII-like_C329-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024160	`PF00201.25`	UDPGT	271	428	4.9e-22	79.1
LXL04_024160	`PF06722.19`	EryCIII-like_C	329	434	6.2e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	UDP-glycosyltransferase 83A1	44.301%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card