LXL04_024103 | RubberDandelionOmics

Gene overview

LXL04_024103

Reference: OH-1004 Chr: Chr05 Coordinates: 81190165-81191862 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

867 bp · LXL04_024103|LXL04_024103|OH1004|cDNA

ATGGACTCTTCATCCGTTCCAAATCGTCTCGATATATTCGAGATTTACCGGCGCTATTGCGAAATCACATCAGACGCATATAATTTTGAAGGAGATGGTTACAGACCAGCCAATGAGTCAAAAAAAGCTAAATTATACAGAGATGCCTTATCCCAGCTCCTACAACTCATCGAGTCAAGAGTGGACAAAAGGATGCCAATACTTGAACAAATCCCTGTGCTCATGTCAAGGCTTCATTTAATGGTAGACTCATGTGAATT...

CDS

Download CDS FASTA

867 bp · LXL04_024103|LXL04_024103|OH1004|CDS

ATGGACTCTTCATCCGTTCCAAATCGTCTCGATATATTCGAGATTTACCGGCGCTATTGCGAAATCACATCAGACGCATATAATTTTGAAGGAGATGGTTACAGACCAGCCAATGAGTCAAAAAAAGCTAAATTATACAGAGATGCCTTATCCCAGCTCCTACAACTCATCGAGTCAAGAGTGGACAAAAGGATGCCAATACTTGAACAAATCCCTGTGCTCATGTCAAGGCTTCATTTAATGGTAGACTCATGTGAATT...

Protein

Download Protein FASTA

288 aa · LXL04_024103|LXL04_024103|OH1004|PROTEIN

MDSSSVPNRLDIFEIYRRYCEITSDAYNFEGDGYRPANESKKAKLYRDALSQLLQLIESRVDKRMPILEQIPVLMSRLHLMVDSCEFSRFYNFMFFICRENGQRNITVSRAIMAWKLVLSGRFRLLNQWCSFVEKNQKHNISEDTWRQVLAFSRCVHENLEGYDPEGAWPVLIDEFVEHMYIINGSEDARGFTCSCDSETETIVDSVPGLKNLPGVKRKLGEELLQFGDSKSNMNLKRMREGCVLSSSSNSGSPSCGVEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024103`
TK1151 ID	TkA06G177290
OH-1004 ID	LXL04_024103
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024103

Location Chr05:81190165-81191862 (-)

Description Similar to CG7427: DCN1-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28970`	May contribute to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes; neddylation of cullins play an essential role in the regulation of SCF-type complexes activity (By similarity).	Genetic characterization of mutants resistant to the antiauxin p-chlorophenoxyisobutyric acid reveals that AAR3, a gene encoding a DCN1-like protein, regulates responses to the synthetic auxin 2,4-dichlorophenoxyacetic acid in Arabidopsis roots.2007 · DOI: 10.1104/pp.107.104844

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024103 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0035212 cell competition in a multicellular organism Biological Process

GO:0045116 protein neddylation Biological Process

GO:2000434 regulation of protein neddylation Biological Process

GO:2000436 positive regulation of protein neddylation Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0031624 ubiquitin conjugating enzyme binding Molecular Function

GO:0032182 ubiquitin-like protein binding Molecular Function

GO:0097602 cullin family protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G28970

dme:Dmel_CG7427

gga:424963

hsa:55208

mmu:102323

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.488

Rank 1 · LXL04_024103 · OH-1004

Nucleus0.462

Rank 2 · LXL04_024103 · OH-1004

Cell membrane0.109

Rank 3 · LXL04_024103 · OH-1004

Mitochondrion0.059

Rank 4 · LXL04_024103 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_024103 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03556.22Cullin_binding83-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024103	`PF03556.22`	Cullin_binding	83	179	8.7e-31	107.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MBG8`	Arabidopsis thaliana	Defective in cullin neddylation protein AAR3	51.689%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card