LXL04_024100 | RubberDandelionOmics

Gene overview

LXL04_024100

Reference: OH-1004 Chr: Chr05 Coordinates: 81094871-81098842 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · LXL04_024100|LXL04_024100|OH1004|cDNA

ATGGAGGGACAAAAGCAGGACGATTACTCGGTTACAATACCTCTACTGCTTGCCAATGGAAAGGAAACAAAGGCGGATGACCAGCAAATcgccgccgccgccgccgccgccaCTTCTACCGGCACTTCCTCCTTCTTCAACACATGTTTCAATGGTCTCAATGCTCTTTCAGGAGTTGGGATTTTATCAGTTCCATACGCGTTAGCATCAGGAGGGTGGTTAAGTTTAATATTACTTTTCACAATAGCGTTCTCGACTTT...

CDS

Download CDS FASTA

1296 bp · LXL04_024100|LXL04_024100|OH1004|CDS

ATGGAGGGACAAAAGCAGGACGATTACTCGGTTACAATACCTCTACTGCTTGCCAATGGAAAGGAAACAAAGGCGGATGACCAGCAAATCGCCGCCGCCGCCGCCGCCGCCACTTCTACCGGCACTTCCTCCTTCTTCAACACATGTTTCAATGGTCTCAATGCTCTTTCAGGAGTTGGGATTTTATCAGTTCCATACGCGTTAGCATCAGGAGGGTGGTTAAGTTTAATATTACTTTTCACAATAGCGTTCTCGACTTT...

Protein

Download Protein FASTA

431 aa · LXL04_024100|LXL04_024100|OH1004|PROTEIN

MEGQKQDDYSVTIPLLLANGKETKADDQQIAAAAAAATSTGTSSFFNTCFNGLNALSGVGILSVPYALASGGWLSLILLFTIAFSTFYTGLLIQRCMNKDTTIKNYPDIGHRAFGKTGRIIVSVTMNIELYLVATGFLILEGDNLSNLLPDVGLDFYGVHLGGKESFVVIVAAIILPTIWLNNMSILSYISASGVLASLIILGSILWVGEFDGVGFREKGKVVNWKGMPSAISLYAFCYCAHPVFPTLYTSMKDRRQFKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024100`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024100

Location Chr05:81094871-81098842 (+)

Description Similar to AVT1J: Amino acid transporter AVT1J

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15240`	Amino acid transporter AVT1J.	No verified direct reference in this release
`At3g28960`	Amino acid transporter AVT1I.	No verified direct reference in this release
`At3g54830`	Amino acid transporter AVT1B.	No verified direct reference in this release
`At2g39130`	Amino acid transporter AVT1C.	No verified direct reference in this release
`At2g41190`	Amino acid transporter AVT1A.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024100 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031090 organelle membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G39130

ath:AT2G41190

ath:AT3G28960

ath:AT3G54830

ath:AT5G15240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.441

Rank 1 · LXL04_024100 · OH-1004

Lysosome / Vacuole0.338

Rank 2 · LXL04_024100 · OH-1004

Endoplasmic reticulum0.119

Rank 3 · LXL04_024100 · OH-1004

Cytoplasm0.101

Rank 4 · LXL04_024100 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_024100 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans42-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024100	`PF01490.25`	Aa_trans	42	423	1.6e-65	222.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXF8`	Arabidopsis thaliana	Amino acid transporter AVT1J	61.823%	Swiss-Prot	strong database homology
`F4J1Q9`	Arabidopsis thaliana	Amino acid transporter AVT1I	60.494%	Swiss-Prot	strong database homology
`F4JE35`	Arabidopsis thaliana	Amino acid transporter AVT1B	45.939%	Swiss-Prot	moderate database homology
`F4IUW3`	Arabidopsis thaliana	Amino acid transporter AVT1C	42.402%	Swiss-Prot	moderate database homology
`O80668`	Arabidopsis thaliana	Amino acid transporter AVT1A	40.826%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card