LXL04_023837 | RubberDandelionOmics

Gene overview

LXL04_023837

Reference: OH-1004 Chr: Chr05 Coordinates: 70406521-70407870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1350 bp · LXL04_023837|LXL04_023837|OH1004|cDNA

ATGAAGTCATCGGAGTTAAAAATGAGGGAAGTTCGTGTTTACATTGCTGTCAGTGTGGTTGCTTTCGGTATATGCTTTGCAGTTGCAATATCCGCATTTTACCTGATCGTTTGCagaagggagaagaagaagaagacgaagaaaACGATGACAACCCAGAATCGTTCATCCTTCAAAAAAAGTGTAGATTTGGAGCTCCAACAGTTAAGTTTAAGCGTAAGAACTGCAAGTGAAAAGAAAGTTTCGTTCGAATCCTCCTC...

CDS

Download CDS FASTA

1350 bp · LXL04_023837|LXL04_023837|OH1004|CDS

ATGAAGTCATCGGAGTTAAAAATGAGGGAAGTTCGTGTTTACATTGCTGTCAGTGTGGTTGCTTTCGGTATATGCTTTGCAGTTGCAATATCCGCATTTTACCTGATCGTTTGCAGAAGGGAGAAGAAGAAGAAGACGAAGAAAACGATGACAACCCAGAATCGTTCATCCTTCAAAAAAAGTGTAGATTTGGAGCTCCAACAGTTAAGTTTAAGCGTAAGAACTGCAAGTGAAAAGAAAGTTTCGTTCGAATCCTCCTC...

Protein

Download Protein FASTA

449 aa · LXL04_023837|LXL04_023837|OH1004|PROTEIN

MKSSELKMREVRVYIAVSVVAFGICFAVAISAFYLIVCRREKKKKTKKTMTTQNRSSFKKSVDLELQQLSLSVRTASEKKVSFESSSQIESLDDHLLPTTPGKLAAVVVQSYTVEELSSATADFSSANLIEGSVYQGRLKGKSVAIKCTNPDTISKIKFDLFHTAARFHPNIMKLLGVCSGVDSFDTGEFLVFEYAKNGSLKDWIHGGLAIKSHFIASCSCLLTWNQRLKICLNIATALQFMHQIINPSYVHRNIKSRNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023837`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023837

Location Chr05:70406521-70407870 (+)

Description Similar to LYK2: Protein LYK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01840`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At2g33580`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At1g51940`	Putative Lysin motif (LysM) receptor kinase that may recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At2g28250`	Receptor-like serine/threonine-protein kinase NCRK.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0538300`	Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to biotic stresses.	Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice.2010 · DOI: 10.1111/j.1365-313x.2010.04324.x Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants.2012 · DOI: 10.1093/pcp/pcs113 A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007 Targeted gene disruption of OsCERK1 reveals its indispensable role in chitin perception and involvement in the peptidoglycan response and immunity in rice.2014 · DOI: 10.1094/mpmi-03-14-0068-r OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023837 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010089 xylem development Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071323 cellular response to chitin Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G51940

ath:AT2G28250

ath:AT2G33580

ath:AT3G01840

dosa:Os08g0538300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.697

Rank 1 · LXL04_023837 · OH-1004

Nucleus0.202

Rank 2 · LXL04_023837 · OH-1004

Cytoplasm0.192

Rank 3 · LXL04_023837 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_023837 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_023837 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr132-415 aa

PF00069.32Pkinase132-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023837	`PF07714.24`	PK_Tyr_Ser-Thr	132	415	1.5e-28	100.5
LXL04_023837	`PF00069.32`	Pkinase	132	412	8.9e-27	94.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGI7`	Arabidopsis thaliana	Protein LYK2	38.816%	Swiss-Prot	moderate database homology
`O22808`	Arabidopsis thaliana	Protein LYK5	33.250%	Swiss-Prot	moderate database homology
`F4IB81`	Arabidopsis thaliana	LysM domain receptor-like kinase 3	32.326%	Swiss-Prot	moderate database homology
`Q8VYY5`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase NCRK	29.977%	Swiss-Prot	weak database homology
`A0A0P0XII1`	Oryza sativa subsp. japonica	Chitin elicitor receptor kinase 1	32.194%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card