LXL04_023342 | RubberDandelionOmics

Gene overview

LXL04_023342

Reference: OH-1004 Chr: Chr05 Coordinates: 33840977-33844478 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · LXL04_023342|LXL04_023342|OH1004|cDNA

ATGAGTTCGTTAGTGGGTTCATCAGTTTTACCGCTCAATTCGCGGAATGTATCTTTTCTCTCCACTGGTTATTGTAAATCTCGCAACAAAATTGACACTTCATCGATCTACACAAGGAGAGTCGTCTGTTGTTGTATGGCTCCACAGAATTTAAAGCCCGCTGATGAATTTCGTCCCTCCAAATTCAACGATTCGTCTTTGAATTTGTTTACAGAGGATTTGGACGAGACCGATGTTCTTCTACAGTGTAAAGATGTTTA...

CDS

Download CDS FASTA

1026 bp · LXL04_023342|LXL04_023342|OH1004|CDS

ATGAGTTCGTTAGTGGGTTCATCAGTTTTACCGCTCAATTCGCGGAATGTATCTTTTCTCTCCACTGGTTATTGTAAATCTCGCAACAAAATTGACACTTCATCGATCTACACAAGGAGAGTCGTCTGTTGTTGTATGGCTCCACAGAATTTAAAGCCCGCTGATGAATTTCGTCCCTCCAAATTCAACGATTCGTCTTTGAATTTGTTTACAGAGGATTTGGACGAGACCGATGTTCTTCTACAGTGTAAAGATGTTTA...

Protein

Download Protein FASTA

341 aa · LXL04_023342|LXL04_023342|OH1004|PROTEIN

MSSLVGSSVLPLNSRNVSFLSTGYCKSRNKIDTSSIYTRRVVCCCMAPQNLKPADEFRPSKFNDSSLNLFTEDLDETDVLLQCKDVYKSFGEKQILRGVNFKIKYGEAVGIIGPSGTGKSTILKIIAGLLTPDKGEVYIRGRKRLGLISDDDMSGLRIGLVFQSAALFDSLTVRENVGFLLYEHSRMPKDEIQELVAETLAAVGLKDVEDRMPSELSGGMKKRVALARSIIYDTTNNTIEPEVLLYDEPTAGLDPIASTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023342`
TK1151 ID	TkA06G363440
OH-1004 ID	LXL04_023342
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023342

Location Chr05:33840977-33844478 (-)

Description Similar to TGD3: Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65410`	ATPase transporter involved in lipid transfer from the endoplasmic reticulum (ER) to plastids, and necessary for thylakoids formation.	A small ATPase protein of Arabidopsis, TGD3, involved in chloroplast lipid import.2007 · DOI: 10.1074/jbc.m704063200 Disruption of Nap14, a plastid-localized non-intrinsic ABC protein in Arabidopsis thaliana results in the over-accumulation of transition metals and in aberrant chloroplast structures.2010 · DOI: 10.1111/j.1365-3040.2010.02124.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023342 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0070508 cholesterol import Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G65410

mbo:BQ2027_MB0674

mle:ML1892

mtc:MT0684

mtu:Rv0655

mtv:RVBD_0655

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · LXL04_023342 · OH-1004

Mitochondrion0.036

Rank 2 · LXL04_023342 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_023342 · OH-1004

Nucleus0.015

Rank 4 · LXL04_023342 · OH-1004

Peroxisome0.012

Rank 5 · LXL04_023342 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran96-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023342	`PF00005.34`	ABC_tran	96	251	2.4e-31	109.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9AT00`	Arabidopsis thaliana	Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic	74.351%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card