LXL04_022405 | RubberDandelionOmics

Gene overview

LXL04_022405

Reference: OH-1004 Chr: Chr04 Coordinates: 149603858-149606109 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_022405|LXL04_022405|OH1004|cDNA

ATGACTCCCCTCCCTCCTAAAAACATCTTCAGCATGTTCAACACCACCATGACCACCTCCTCTCCTACCCTCTCTCCGGCCACCGCCCGCCACTTCTGGCTGGAAATTCAGATCATAGAGCTTCTCGCCGCCGTTTTGGTCTTCATAATCATACATTCTCTTCGCCAACGAAAAAAACACGGCCTACCCGTATGGCCATTTCTCGGGATGCTACCTTCATTGGTTCTCGGTCTTCGTGTCGACATGTACGAATGGATTTC...

CDS

Download CDS FASTA

1659 bp · LXL04_022405|LXL04_022405|OH1004|CDS

ATGACTCCCCTCCCTCCTAAAAACATCTTCAGCATGTTCAACACCACCATGACCACCTCCTCTCCTACCCTCTCTCCGGCCACCGCCCGCCACTTCTGGCTGGAAATTCAGATCATAGAGCTTCTCGCCGCCGTTTTGGTCTTCATAATCATACATTCTCTTCGCCAACGAAAAAAACACGGCCTACCCGTATGGCCATTTCTCGGGATGCTACCTTCATTGGTTCTCGGTCTTCGTGTCGACATGTACGAATGGATTTC...

Protein

Download Protein FASTA

552 aa · LXL04_022405|LXL04_022405|OH1004|PROTEIN

MTPLPPKNIFSMFNTTMTTSSPTLSPATARHFWLEIQIIELLAAVLVFIIIHSLRQRKKHGLPVWPFLGMLPSLVLGLRVDMYEWISQVLCRQNGTFTFRGPWFTNLNCIVTSDPRNLEHLLKTRFQAYPKGPYFRHALRDLLGNGIFNADDDIWQRQRKTASIEFHSSKFRNLTTESLLELVHRRLLPVLKESLDRSDEIDLQDILLRLTFDNVCMIAFGVDPGCLSPGLPEIPFAQAFEAATEATLLRFVTPTLMWKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022405`
TK1151 ID	TkA05G465040
OH-1004 ID	LXL04_022405
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 98.944 / OH-1004 50.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022405

Location Chr04:149603858-149606109 (-)

Description Similar to CYP86B1: Cytochrome P450 86B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23190`	Involved in very long chain fatty acids (VLCFA) omega- hydroxylation.	CYP86B1 is required for very long chain omega-hydroxyacid and alpha, omega -dicarboxylic acid synthesis in root and seed suberin polyester.2009 · DOI: 10.1104/pp.109.141408 Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907
`At1g63710`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At1g01600`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335 Nanoridges that characterize the surface morphology of flowers require the synthesis of cutin polyester.2009 · DOI: 10.1073/pnas.0909090106
`At4g00360`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Arabidopsis CYP86A2 represses Pseudomonas syringae type III genes and is required for cuticle development.2004 · DOI: 10.1038/sj.emboj.7600290 Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ag:AAZ39642

ath:AT1G01600

ath:AT1G63710

ath:AT4G00360

ath:AT5G23190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.910

Rank 1 · LXL04_022405 · OH-1004

Golgi apparatus0.047

Rank 2 · LXL04_022405 · OH-1004

Cytoplasm0.040

Rank 3 · LXL04_022405 · OH-1004

Cell membrane0.038

Rank 4 · LXL04_022405 · OH-1004

Nucleus0.029

Rank 5 · LXL04_022405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45064-529 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022405	`PF00067.28`	p450	64	529	1.7e-70	238.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY1`	Arabidopsis thaliana	Cytochrome P450 86B1	72.150%	Swiss-Prot	strong database homology
`Q9CAD6`	Arabidopsis thaliana	Cytochrome P450 86A7	47.817%	Swiss-Prot	moderate database homology
`Q9LMM1`	Arabidopsis thaliana	Cytochrome P450 86A4	47.399%	Swiss-Prot	moderate database homology
`O23066`	Arabidopsis thaliana	Cytochrome P450 86A2	46.351%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card