LXL04_021878 | RubberDandelionOmics

Gene overview

LXL04_021878

Reference: OH-1004 Chr: Chr04 Coordinates: 139001113-139003810 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1279 bp · LXL04_021878|LXL04_021878|OH1004|cDNA

GACTATAACCTTTTCCCGCCAAAATCCCATCAATTTCTACCCCTCTCTCCACCACTCTGTAGAGCTTCTGTATTGTTGTTCTTCGTCTCCACTCTTTCTCTCTAGAATCAACAACAGTTTCGCTCTCACACGCAAGAAAATGTTGGAGCTTAGGTTAGTGCAGGGTAGTTTGTTGAAGAAAGTGATGGAATCCATCAAGGATCTGGTGAACGACGCTAACTTCGACTGTTCGGCGGCGGGATTCTCACTGCAAGCCATGG...

CDS

Download CDS FASTA

1212 bp · LXL04_021878|LXL04_021878|OH1004|CDS

CTGTATTGTTGTTCTTCGTCTCCACTCTTTCTCTCTAGAATCAACAACAGTTTCGCTCTCACACGCAAGAAAATGTTGGAGCTTAGGTTAGTGCAGGGTAGTTTGTTGAAGAAAGTGATGGAATCCATCAAGGATCTGGTGAACGACGCTAACTTCGACTGTTCGGCGGCGGGATTCTCACTGCAAGCCATGGATTCAAGCCATGTAGCGCTTGTGTCGCTACTTCTCAGATCTGAGGGTTTCGAGCACTACCGATGCGA...

Protein

Download Protein FASTA

403 aa · LXL04_021878|LXL04_021878|OH1004|PROTEIN

MYCCSSSPLFLSRINNSFALTRKKMLELRLVQGSLLKKVMESIKDLVNDANFDCSAAGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMAKMLRCAGNDDIVTIKADDGGDCVTFMFESPNQDKIADFEMKLMDIDSEHLGIPEAEYEAIVRMPSSEFARICKDLSTIGDTVVISVTKEGVKFSTRGDIGTANIVCRQNTSVDKPEEATIIEMETPVSLTFALRYMNSFTKATPLASQVTVSLSSELPVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021878`
TK1151 ID	TkA05G429460
OH-1004 ID	LXL04_021878
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 94.236 / OH-1004 93.300 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021878

Location Chr04:139001113-139003810 (+)

Description Similar to Proliferating cell nuclear antigen large form

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0805200`	Confers DNA tethering and processivity to DNA polymerases and other proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021878 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006272 leading strand elongation Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006298 mismatch repair Biological Process

GO:0019985 translesion synthesis Biological Process

GO:0070207 protein homotrimerization Biological Process

GO:0140861 DNA repair-dependent chromatin remodeling Biological Process

GO:1902969 mitotic DNA replication Biological Process

GO:0005634 nucleus Cellular Component

GO:0043626 PCNA complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003684 damaged DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0805200

nta:107779602

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · LXL04_021878 · OH-1004

Cytoplasm0.174

Rank 2 · LXL04_021878 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_021878 · OH-1004

Mitochondrion0.016

Rank 4 · LXL04_021878 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_021878 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00705.24PCNA_N25-149 aa

PF02747.21PCNA_C151-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021878	`PF00705.24`	PCNA_N	25	149	9.2e-58	194.2
LXL04_021878	`PF02747.21`	PCNA_C	151	278	4e-60	202.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P17070`	Oryza sativa subsp. japonica	DNA sliding clamp PCNA	88.889%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card