LXL04_021845 | RubberDandelionOmics

Gene overview

LXL04_021845

Reference: OH-1004 Chr: Chr04 Coordinates: 138534869-138542893 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3339 bp · LXL04_021845|LXL04_021845|OH1004|cDNA

ATGTTTGCTAAATTATTTCACAAAACTCCGCAGCAACAATCATCACCGGAGGATGATGATCCAAAATTGAAAGACTTTGAACCCCGCATTGTTGTTCATTATGGTATCCCAACTACTTCATCAATCCTGGCCTTTGATCCTCTTCAGCATTTACTAGCTATAGGCACACTGGATGGAAGAATAAAGGTGATTGGTGGTGATAACATTGAATGCATTTTAATATCTCCAAAACCAATACCCCTGAAAAACCTAGAGTTTTT...

CDS

Download CDS FASTA

3339 bp · LXL04_021845|LXL04_021845|OH1004|CDS

ATGTTTGCTAAATTATTTCACAAAACTCCGCAGCAACAATCATCACCGGAGGATGATGATCCAAAATTGAAAGACTTTGAACCCCGCATTGTTGTTCATTATGGTATCCCAACTACTTCATCAATCCTGGCCTTTGATCCTCTTCAGCATTTACTAGCTATAGGCACACTGGATGGAAGAATAAAGGTGATTGGTGGTGATAACATTGAATGCATTTTAATATCTCCAAAACCAATACCCCTGAAAAACCTAGAGTTTTT...

Protein

Download Protein FASTA

1112 aa · LXL04_021845|LXL04_021845|OH1004|PROTEIN

MFAKLFHKTPQQQSSPEDDDPKLKDFEPRIVVHYGIPTTSSILAFDPLQHLLAIGTLDGRIKVIGGDNIECILISPKPIPLKNLEFFQNQGFLVSVSNENDIQVWDLEKRRLAANLQWGSNISAFSVVCGTNYMYVGDEYGYLSVLKYDFEEGSIQPMPYQIPPDLISDEGGVQIPDHQSVVGLLAQPCSSGKRVLIAYQNGLMFLWDVSEDKAILIRGPKDLQLKDEIVIRSTGEIKRETINNKPDEEQQTEKEISALC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021845`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_021845`
Location	Chr04:138534869-138542893 (+)
Description	Similar to STXBP5L: Syntaxin-binding protein 5-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021845` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0015031 protein transport Biological Process GO:0017157 regulation of exocytosis Biological Process GO:0042593 glucose homeostasis Biological Process GO:0045921 positive regulation of exocytosis Biological Process GO:0050714 positive regulation of protein secretion Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005892 acetylcholine-gated channel complex Cellular Component GO:0030141 secretory granule Cellular Component
KEGG gene cross-reference	hsa:134957 hsa:9515 mmu:207227 rno:81022 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · LXL04_021845 · OH-1004

Nucleus0.235

Rank 2 · LXL04_021845 · OH-1004

Golgi apparatus0.166

Rank 3 · LXL04_021845 · OH-1004

Lysosome / Vacuole0.149

Rank 4 · LXL04_021845 · OH-1004

Cell membrane0.143

Rank 5 · LXL04_021845 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25173.2Beta-prop_WDR3_1st41-128 aa

PF23381.2Beta-prop_IFT122_1st42-147 aa

PF24796.2WDR5543-145 aa

PF23381.2Beta-prop_IFT122_1st243-309 aa

PF00957.28Synaptobrevin1067-1109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021845	`PF25173.2`	Beta-prop_WDR3_1st	41	128	1.2e-16	61.6
LXL04_021845	`PF23381.2`	Beta-prop_IFT122_1st	42	147	6.8e-17	62.4
LXL04_021845	`PF24796.2`	WDR55	43	145	3.4e-09	36.9
LXL04_021845	`PF23381.2`	Beta-prop_IFT122_1st	243	309	6.8e-17	62.4
LXL04_021845	`PF00957.28`	Synaptobrevin	1067	1109	4.5e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card