Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1854 bp · LXL04_021839|LXL04_021839|OH1004|cDNA
ATGTTCTACTCTCACCAGCTCCTTGCTCGAAAAGCTCCTCTGGGACAAATCTGGATGGCGGCAACAATGCATGCGAAAATACACAGGAGGAAGCTCGACAAGCTGAATATTATCAGCATCTGTGAAGAAATATTGAATCCATCGGTTCCAATGGCTCTCAGATTATCCGGAATTCTCATGGGTGGAGTCGTTATTGTATACGAGCGCAAAGTAAAACTTCTCTATGAGGATGTGACTCGTTTTCTGGTTGAAATCAATGA...
1854 bp · LXL04_021839|LXL04_021839|OH1004|CDS
ATGTTCTACTCTCACCAGCTCCTTGCTCGAAAAGCTCCTCTGGGACAAATCTGGATGGCGGCAACAATGCATGCGAAAATACACAGGAGGAAGCTCGACAAGCTGAATATTATCAGCATCTGTGAAGAAATATTGAATCCATCGGTTCCAATGGCTCTCAGATTATCCGGAATTCTCATGGGTGGAGTCGTTATTGTATACGAGCGCAAAGTAAAACTTCTCTATGAGGATGTGACTCGTTTTCTGGTTGAAATCAATGA...
Protein
Download Protein FASTA617 aa · LXL04_021839|LXL04_021839|OH1004|PROTEIN
MFYSHQLLARKAPLGQIWMAATMHAKIHRRKLDKLNIISICEEILNPSVPMALRLSGILMGGVVIVYERKVKLLYEDVTRFLVEINEAWKVKTVRDPTILPKGRSHAKYADITLPDNEPTDLGDIEQPLQFSNSETQRGFQRSAYTEMKLDSINEAYTSHNLGKQDIPHDHHQANIDDITMCDKFDSHQTEPAPFNPFERFDIDGDEETQANSSFHDHTDIPSTLIPSPPPQNEPQFQNPDEIHEQHPGDFPNQQVSDED...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021839 |
|---|---|
| TK1151 ID | TkA05G428730 |
| OH-1004 ID | LXL04_021839 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021839 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:138394329-138398252 (+) | |||||||||
| Description | Similar to SYN1: Sister chromatid cohesion 1 protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0006302 double-strand break repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007059 chromosome segregation Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0010032 meiotic chromosome condensation Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G05490 ath:AT5G16270 bta:540966 hsa:5885 mmu:19357 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04825.19Rad21_Rec8_N1-95 aaPF04824.22Rad21_Rec8567-617 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021839 | PF04825.19 | Rad21_Rec8_N | 1 | 95 | 7.2e-32 | 110.5 |
| LXL04_021839 | PF04824.22 | Rad21_Rec8 | 567 | 617 | 5.8e-16 | 58.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.