LXL04_021824 | RubberDandelionOmics

Gene overview

LXL04_021824

Reference: OH-1004 Chr: Chr04 Coordinates: 137702550-137705638 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2316 bp · LXL04_021824|LXL04_021824|OH1004|cDNA

ATGGAGTCCAATTTCATTTTCCACAAATACCCTTTTCAAAAAGTTCACCATCTTTCAACCTGTACTTTCCACCCATTCAAGTCCAGCAAAAACACACACTATTTCACCTTACTACTACACCTACTAATAATTTGCAGTCTCCCTTTCGCTGTTTCAGTTAAATCATGGGATGGAATTATAGTTACAGAATCCAACCTTCAAGCTCTTCAAGCTTTGAAACAAGAACTCATTGACCCAAATGGGTTTTTGAAAAGCTGGAA...

CDS

Download CDS FASTA

2316 bp · LXL04_021824|LXL04_021824|OH1004|CDS

ATGGAGTCCAATTTCATTTTCCACAAATACCCTTTTCAAAAAGTTCACCATCTTTCAACCTGTACTTTCCACCCATTCAAGTCCAGCAAAAACACACACTATTTCACCTTACTACTACACCTACTAATAATTTGCAGTCTCCCTTTCGCTGTTTCAGTTAAATCATGGGATGGAATTATAGTTACAGAATCCAACCTTCAAGCTCTTCAAGCTTTGAAACAAGAACTCATTGACCCAAATGGGTTTTTGAAAAGCTGGAA...

Protein

Download Protein FASTA

771 aa · LXL04_021824|LXL04_021824|OH1004|PROTEIN

MESNFIFHKYPFQKVHHLSTCTFHPFKSSKNTHYFTLLLHLLIICSLPFAVSVKSWDGIIVTESNLQALQALKQELIDPNGFLKSWNDSGYGACSGGWEGIKCAQGQVIIIQLPWRSLGGQISSKIGQLQALRKLSVHNNAIGGSIPMELGFLINLRGIQLFNNKFSGSIPPTLGSCTLLQNLDFGNNSLVGEIPDSFGNCTKLYNVNLSLNSLSGSVPVSLSQSNSLMFLSLQFNNFSGVLPDSWGGGKNGDKSIVKSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021824`
TK1151 ID	TkA05G425800
OH-1004 ID	LXL04_021824
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021824

Location Chr04:137702550-137705638 (+)

Description Similar to IMK3: Probable leucine-rich repeat receptor-like protein kinase IMK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0777400`	Receptor kinase that may be involved in the regulation of cell proliferation and cell growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021824 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033612 receptor serine/threonine kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51740

ath:AT3G56100

dosa:Os02g0777400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.875

Rank 1 · LXL04_021824 · OH-1004

Endoplasmic reticulum0.091

Rank 2 · LXL04_021824 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_021824 · OH-1004

Nucleus0.043

Rank 4 · LXL04_021824 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_021824 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_266-103 aa

PF23598.2LRR_14275-349 aa

PF13855.13LRR_8301-339 aa

PF12799.14LRR_4304-345 aa

PF07714.24PK_Tyr_Ser-Thr488-753 aa

PF00069.32Pkinase488-751 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021824	`PF08263.18`	LRRNT_2	66	103	3.1e-09	37.7
LXL04_021824	`PF23598.2`	LRR_14	275	349	5.2e-12	45.9
LXL04_021824	`PF13855.13`	LRR_8	301	339	5.1e-18	65.3
LXL04_021824	`PF12799.14`	LRR_4	304	345	4.6e-12	46.5
LXL04_021824	`PF07714.24`	PK_Tyr_Ser-Thr	488	753	6.2e-37	128.0
LXL04_021824	`PF00069.32`	Pkinase	488	751	3.5e-36	125.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	61.238%	Swiss-Prot	strong database homology
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	56.736%	Swiss-Prot	strong database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	33.479%	Swiss-Prot	moderate database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	36.532%	Swiss-Prot	moderate database homology
`I1Z695`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase ER2	33.537%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card