LXL04_021785 | RubberDandelionOmics

Gene overview

LXL04_021785

Reference: OH-1004 Chr: Chr04 Coordinates: 136961214-136963281 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_021785|LXL04_021785|OH1004|cDNA

ATGGGAGGGCCTGGTTGTGAATCTGTTGATAACTTCAAGTCAATTCTGGAACAAGAAGGAATTCACCATCTTTTATCCAATGAACTCAAGGTACCTTTATCAACATCATGTAAACAAAAAACAGTTTGCTTATTGTTTTCTGCAAATTGGAGTAGGCCTTGTAAGGCTTTTATCCCACAACTAGTGCAAACATACAAAACCCTACAAGATGTTGACCATGAGGTAGAAATTATCTTCATATCATTTGACCATGATGAAAA...

CDS

Download CDS FASTA

1218 bp · LXL04_021785|LXL04_021785|OH1004|CDS

ATGGGAGGGCCTGGTTGTGAATCTGTTGATAACTTCAAGTCAATTCTGGAACAAGAAGGAATTCACCATCTTTTATCCAATGAACTCAAGGTACCTTTATCAACATCATGTAAACAAAAAACAGTTTGCTTATTGTTTTCTGCAAATTGGAGTAGGCCTTGTAAGGCTTTTATCCCACAACTAGTGCAAACATACAAAACCCTACAAGATGTTGACCATGAGGTAGAAATTATCTTCATATCATTTGACCATGATGAAAA...

Protein

Download Protein FASTA

405 aa · LXL04_021785|LXL04_021785|OH1004|PROTEIN

MGGPGCESVDNFKSILEQEGIHHLLSNELKVPLSTSCKQKTVCLLFSANWSRPCKAFIPQLVQTYKTLQDVDHEVEIIFISFDHDENGFKEHMKSMPWLVVPFDVNLQKKLGNLYKVDQIPSFIPLNIDTKLPAKDSVGLIKDYGPDAFPFTKKRQEELKAIDEEKRQEGKLEHLFAYGINSKGEKIHASELVGKTIGLYFGAHWCPPCREFTTQLIEAYNDIGKNKDQEFEVVYVSTDKDVKEFELGLNKMPWVAIPFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021785`
TK1151 ID	TkA05G420990
OH-1004 ID	LXL04_021785
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 71.111 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021785

Location Chr04:136961214-136963281 (-)

Description Similar to At4g31240: Probable nucleoredoxin 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31240`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At1g60420`	Probable thiol-disulfide oxidoreductase required for pollen tube growth and pollen function in the pistil.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0608600`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`Os01g0794400`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`Os03g0405900`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021785 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004791 thioredoxin-disulfide reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G60420

ath:AT4G31240

dosa:Os04g0608600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.649

Rank 1 · LXL04_021785 · OH-1004

Nucleus0.287

Rank 2 · LXL04_021785 · OH-1004

Cell membrane0.115

Rank 3 · LXL04_021785 · OH-1004

Mitochondrion0.098

Rank 4 · LXL04_021785 · OH-1004

Endoplasmic reticulum0.084

Rank 5 · LXL04_021785 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00578.28AhpC-TSA31-117 aa

PF00085.27Thioredoxin38-103 aa

PF13905.13Thioredoxin_840-126 aa

PF08534.17Redoxin180-285 aa

PF00578.28AhpC-TSA181-286 aa

PF13905.13Thioredoxin_8194-287 aa

PF13098.14Thioredoxin_2194-290 aa

PF03107.23C1_2334-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021785	`PF00578.28`	AhpC-TSA	31	117	1.9e-14	54.4
LXL04_021785	`PF00085.27`	Thioredoxin	38	103	1.6e-10	41.6
LXL04_021785	`PF13905.13`	Thioredoxin_8	40	126	9.5e-53	177.3
LXL04_021785	`PF08534.17`	Redoxin	180	285	1.3e-08	35.4
LXL04_021785	`PF00578.28`	AhpC-TSA	181	286	1.9e-14	54.4
LXL04_021785	`PF13905.13`	Thioredoxin_8	194	287	9.5e-53	177.3
LXL04_021785	`PF13098.14`	Thioredoxin_2	194	290	1e-11	45.9
LXL04_021785	`PF03107.23`	C1_2	334	375	4.8e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZQ0`	Arabidopsis thaliana	Probable nucleoredoxin 3	56.183%	Swiss-Prot	strong database homology
`O80763`	Arabidopsis thaliana	Probable nucleoredoxin 1	37.183%	Swiss-Prot	moderate database homology
`Q7XPE8`	Oryza sativa subsp. japonica	Probable nucleoredoxin 3	46.742%	Swiss-Prot	moderate database homology
`Q0JIL1`	Oryza sativa subsp. japonica	Probable nucleoredoxin 2	33.962%	Swiss-Prot	moderate database homology
`Q7Y0F2`	Oryza sativa subsp. japonica	Probable nucleoredoxin 1-2	34.465%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card