LXL04_021591 | RubberDandelionOmics

Gene overview

LXL04_021591

Reference: OH-1004 Chr: Chr04 Coordinates: 132959616-132963452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1905 bp · LXL04_021591|LXL04_021591|OH1004|cDNA

ATGTGGAACGATGTCGCAAAATCAACACTCTGGTTTGGGTTCGGTTCACTCTGTTTCTTATCTTCATGTTTCTCAACGGGAATTAGCTTTAGCATGTTTTCTGTGATATCCCACCTCAGCCTACTGTGTTTGGGCGTTTCATTCTTCTCAAACTCCATTGCCCAAAGTTCAGAAAGCAAGAAAAAGCGTAAGCTTAAAGAAGACGACATTCTAAAAGCTGCTAGGGTTATACTTCCCGCATTGAATTTTGTAATTTCAAA...

CDS

Download CDS FASTA

1905 bp · LXL04_021591|LXL04_021591|OH1004|CDS

ATGTGGAACGATGTCGCAAAATCAACACTCTGGTTTGGGTTCGGTTCACTCTGTTTCTTATCTTCATGTTTCTCAACGGGAATTAGCTTTAGCATGTTTTCTGTGATATCCCACCTCAGCCTACTGTGTTTGGGCGTTTCATTCTTCTCAAACTCCATTGCCCAAAGTTCAGAAAGCAAGAAAAAGCGTAAGCTTAAAGAAGACGACATTCTAAAAGCTGCTAGGGTTATACTTCCCGCATTGAATTTTGTAATTTCAAA...

Protein

Download Protein FASTA

634 aa · LXL04_021591|LXL04_021591|OH1004|PROTEIN

MWNDVAKSTLWFGFGSLCFLSSCFSTGISFSMFSVISHLSLLCLGVSFFSNSIAQSSESKKKRKLKEDDILKAARVILPALNFVISKAREVFSGEPSMTLKVAPFLLLGFDYGHIVTFKRLCALGFFIGFTGPKLYSLYSIQIHKRSERLKKRILEAWGGCSHKKIVAGSVVTAFWNLTSIKTRIFAAFICVVIFRRYRQQSISSDMDLFFWLQLYTLFIGADMRYHLMLFIEEFKKEFGQFDRSGFYRQQRKRKQDKIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021591`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021591

Location Chr04:132959616-132963452 (+)

Description Similar to SFH6: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39170`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At2g21520`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At1g19650`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At1g75370`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g36490`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021591 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008526 phosphatidylinositol transfer activity Molecular Function

GO:0070300 phosphatidic acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G19650

ath:AT1G75370

ath:AT2G21520

ath:AT4G36490

ath:AT4G39170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.500

Rank 1 · LXL04_021591 · OH-1004

Nucleus0.184

Rank 2 · LXL04_021591 · OH-1004

Cytoplasm0.124

Rank 3 · LXL04_021591 · OH-1004

Golgi apparatus0.123

Rank 4 · LXL04_021591 · OH-1004

Cell membrane0.093

Rank 5 · LXL04_021591 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02453.24Reticulon1-146 aa

PF00650.26CRAL_TRIO275-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021591	`PF02453.24`	Reticulon	1	146	3.4e-24	86.2
LXL04_021591	`PF00650.26`	CRAL_TRIO	275	368	3e-19	70.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JVA6`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH6	61.290%	Swiss-Prot	moderate database homology
`F4IHJ0`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH8	57.812%	Swiss-Prot	moderate database homology
`F4HP88`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH4	48.413%	Swiss-Prot	moderate database homology
`Q8GXC6`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH5	49.081%	Swiss-Prot	moderate database homology
`Q94A34`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH12	45.730%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card