LXL04_021359 | RubberDandelionOmics

Gene overview

LXL04_021359

Reference: OH-1004 Chr: Chr04 Coordinates: 128149630-128150175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · LXL04_021359|LXL04_021359|OH1004|cDNA

ATGAGCCCTAGAAACTTTCTTGAAGGTGATCATAAAGAACAGATGAAAAGTGGAGTCACGATTAATGGTCCACGACCTTCGCCATTAAAGCTTAAACAAGAATCACACACCATTCAAAAACAACATCACCAACAGATGAGAAAGCCGATCATAATCTACACTTATTCTCCGGAAGTTATCCACACCAAACCTAATGACTTCATGGCTCTTGTTCAGAAACTCACGGGTCATAATTCTGTTCCTAAAGATCGAGAAACAAG...

CDS

Download CDS FASTA

546 bp · LXL04_021359|LXL04_021359|OH1004|CDS

ATGAGCCCTAGAAACTTTCTTGAAGGTGATCATAAAGAACAGATGAAAAGTGGAGTCACGATTAATGGTCCACGACCTTCGCCATTAAAGCTTAAACAAGAATCACACACCATTCAAAAACAACATCACCAACAGATGAGAAAGCCGATCATAATCTACACTTATTCTCCGGAAGTTATCCACACCAAACCTAATGACTTCATGGCTCTTGTTCAGAAACTCACGGGTCATAATTCTGTTCCTAAAGATCGAGAAACAAG...

Protein

Download Protein FASTA

181 aa · LXL04_021359|LXL04_021359|OH1004|PROTEIN

MSPRNFLEGDHKEQMKSGVTINGPRPSPLKLKQESHTIQKQHHQQMRKPIIIYTYSPEVIHTKPNDFMALVQKLTGHNSVPKDRETRPKKTLKNRKDNELSNDSGVTHEKTSIMKAKSTNFNAHSNTYMADIPLFTPNLNDYFCSPRGLFRFTDMVSSSPNMSTSLSPESLVELMKILPDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021359`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021359

Location Chr04:128149630-128150175 (-)

Description Similar to VQ8: VQ motif-containing protein 8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68450`	May be involved in chloroplast development.	No verified direct reference in this release
`At3g18360`	May function as negative regulator of plant defense.	No verified direct reference in this release
`At3g18690`	Regulator of plant defense response.	The MAP kinase substrate MKS1 is a regulator of plant defense responses.2005 · DOI: 10.1038/sj.emboj.7600737
`At1g21320`	Alternative splicing (AS) regulator that binds to specific mRNAs and modulates auxin effects on the transcriptome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021359 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G21320

ath:AT1G68450

ath:AT3G18360

ath:AT3G18690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.735

Rank 1 · LXL04_021359 · OH-1004

Cytoplasm0.363

Rank 2 · LXL04_021359 · OH-1004

Cell membrane0.083

Rank 3 · LXL04_021359 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_021359 · OH-1004

Plastid0.017

Rank 5 · LXL04_021359 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05678.20VQ54-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021359	`PF05678.20`	VQ	54	80	1.6e-11	44.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA36`	Arabidopsis thaliana	VQ motif-containing protein 8, chloroplastic	33.548%	Swiss-Prot	moderate database homology
`Q9LS54`	Arabidopsis thaliana	VQ motif-containing protein 20	50.909%	Swiss-Prot	weak database homology
`Q8LGD5`	Arabidopsis thaliana	Protein MKS1	33.684%	Swiss-Prot	weak database homology
`F4HWF9`	Arabidopsis thaliana	Nuclear speckle RNA-binding protein B	39.474%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card