LXL04_021306 | RubberDandelionOmics

Gene overview

LXL04_021306

Reference: OH-1004 Chr: Chr04 Coordinates: 126950592-126957594 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5982 bp · LXL04_021306|LXL04_021306|OH1004|cDNA

ATGACGTTGTTCTTGTCCGACGAAGAGTACGCTCGCTGCTCCCACGACCCTTCTTTGATTGCGCAGAAAGCCGATGCCTATATCAGAGAACTCTACAATCAACTCGAGACTGAAAAAGCCCAATACGATGCTTCCTCCATAACCGCCGAACAGACTTGCTCGATTCTCGAGCAAAAATATGTTTCTCTCAAATCTGAATTTACTGCGCTTCAATCGCAGCACTCGCAGCTCAATTCCACTCTCGAGGAACGTGTCTCTGA...

CDS

Download CDS FASTA

5982 bp · LXL04_021306|LXL04_021306|OH1004|CDS

ATGACGTTGTTCTTGTCCGACGAAGAGTACGCTCGCTGCTCCCACGACCCTTCTTTGATTGCGCAGAAAGCCGATGCCTATATCAGAGAACTCTACAATCAACTCGAGACTGAAAAAGCCCAATACGATGCTTCCTCCATAACCGCCGAACAGACTTGCTCGATTCTCGAGCAAAAATATGTTTCTCTCAAATCTGAATTTACTGCGCTTCAATCGCAGCACTCGCAGCTCAATTCCACTCTCGAGGAACGTGTCTCTGA...

Protein

Download Protein FASTA

1993 aa · LXL04_021306|LXL04_021306|OH1004|PROTEIN

MTLFLSDEEYARCSHDPSLIAQKADAYIRELYNQLETEKAQYDASSITAEQTCSILEQKYVSLKSEFTALQSQHSQLNSTLEERVSELAQIQADKHQIYLQSVLSLFLCSFTMLMVVFGYKYLLDAIGTVLVNFIACAERGLSSSFHIGKDGEIERLSLEASELQKSKSQLLQMIEHKDLEISEKNTSIKGYLDKIVSLTENTSSKESRTRELEAELARVHTSLARLSQEKELVERHNVWLNDELTTKVNNLLELRKSHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021306`
TK1151 ID	TkA05G378680
OH-1004 ID	LXL04_021306
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 98.610 / OH-1004 98.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021306

Location Chr04:126950592-126957594 (+)

Description Similar to NUA: Nuclear-pore anchor

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79280`	Component of the nuclear pore complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021306 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006404 RNA import into nucleus Biological Process

GO:0006405 RNA export from nucleus Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006611 protein export from nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006999 nuclear pore organization Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010965 regulation of mitotic sister chromatid separation Biological Process

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

KEGG gene cross-reference

ath:AT1G79280

cthr:CTHT_0041070

hsa:7175

mmu:108989

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.642

Rank 1 · LXL04_021306 · OH-1004

Cytoplasm0.291

Rank 2 · LXL04_021306 · OH-1004

Golgi apparatus0.056

Rank 3 · LXL04_021306 · OH-1004

Cell membrane0.032

Rank 4 · LXL04_021306 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_021306 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25481.2Nucleoprot-TPR215-294 aa

PF25785.2TPR533-634 aa

PF07926.18TPR_MLP1_21077-1204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021306	`PF25481.2`	Nucleoprot-TPR	215	294	6.2e-22	78.1
LXL04_021306	`PF25785.2`	TPR	533	634	2e-23	83.5
LXL04_021306	`PF07926.18`	TPR_MLP1_2	1077	1204	7.6e-25	88.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A4GSN8`	Arabidopsis thaliana	Nuclear-pore anchor	44.728%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card