LXL04_021175 | RubberDandelionOmics

Gene overview

LXL04_021175

Reference: OH-1004 Chr: Chr04 Coordinates: 123272315-123276820 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1737 bp · LXL04_021175|LXL04_021175|OH1004|cDNA

atggaaACTAATACCGCACTTTTTTTACTCCAAATAATAAACCTAATTAAACCTAAAGAACAATCGCGGCTCCATCTGTCCATCTCTCCCGTTTCCGACTTTTCTCCTGGTCTCGGTCTCTTGCTCTCTATCGGCGACTCCAAGGCTTCAACTCCGCTGCCGGCGTCGCACTGGCCACTGGTCCACTGGTCGCACTTCATCTCCAACACATTTCGTCTCCGCCGGTCGCATCACTTCATCTTCAGGTATTTCAAAATTTC...

CDS

Download CDS FASTA

1737 bp · LXL04_021175|LXL04_021175|OH1004|CDS

ATGGAAACTAATACCGCACTTTTTTTACTCCAAATAATAAACCTAATTAAACCTAAAGAACAATCGCGGCTCCATCTGTCCATCTCTCCCGTTTCCGACTTTTCTCCTGGTCTCGGTCTCTTGCTCTCTATCGGCGACTCCAAGGCTTCAACTCCGCTGCCGGCGTCGCACTGGCCACTGGTCCACTGGTCGCACTTCATCTCCAACACATTTCGTCTCCGCCGGTCGCATCACTTCATCTTCAGGTATTTCAAAATTTC...

Protein

Download Protein FASTA

578 aa · LXL04_021175|LXL04_021175|OH1004|PROTEIN

METNTALFLLQIINLIKPKEQSRLHLSISPVSDFSPGLGLLLSIGDSKASTPLPASHWPLVHWSHFISNTFRLRRSHHFIFRYFKISFSMFDVLKNNRGSIYPSLLFPTFLLVSVSFSLSATPRLQLRCRPNIGGYCLMGKIPLDFLHLSWEKSPNLSLGERVEVMSTVSMQSCFMKSILQQVPMMISAEELGAKDISPYDVYSYKNIPRNSMSHVIRLRTGNVVFNYKYYNNILQRSEVTEDYSCPFCLVKCASYKVNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021175`
TK1151 ID	TkA07G099510
OH-1004 ID	LXL04_021175
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.100
Protein coverage (%)	TK1151 49.194 / OH-1004 8.997 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021175

Location Chr04:123272315-123276820 (-)

Description Similar to SPY: Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11540`	Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway and circadian clock.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0559300`	Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021175 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0030154 cell differentiation Biological Process

GO:0036066 protein O-linked glycosylation via fucose Biological Process

GO:0048511 rhythmic process Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016262 protein N-acetylglucosaminyltransferase activity Molecular Function

GO:0046922 peptide-O-fucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11540

dosa:Os08g0559300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.328

Rank 1 · LXL04_021175 · OH-1004

Cytoplasm0.282

Rank 2 · LXL04_021175 · OH-1004

Mitochondrion0.142

Rank 3 · LXL04_021175 · OH-1004

Endoplasmic reticulum0.130

Rank 4 · LXL04_021175 · OH-1004

Cell membrane0.125

Rank 5 · LXL04_021175 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24663.2DUF7651128-178 aa

PF23320.2Zn_SUZ12222-257 aa

PF13844.13Glyco_transf_41417-569 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021175	`PF24663.2`	DUF7651	128	178	1e-20	74.8
LXL04_021175	`PF23320.2`	Zn_SUZ12	222	257	1.7e-13	50.8
LXL04_021175	`PF13844.13`	Glyco_transf_41	417	569	6.9e-22	78.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96301`	Arabidopsis thaliana	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY	75.543%	Swiss-Prot	weak database homology
`Q6YZI0`	Oryza sativa subsp. japonica	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY	75.543%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card