LXL04_020855 | RubberDandelionOmics

Gene overview

LXL04_020855

Reference: OH-1004 Chr: Chr04 Coordinates: 111508331-111509325 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_020855|LXL04_020855|OH1004|cDNA

ATGGAAGAAATGTATGGCTTCCACTCGACATCGGATTACACAATTTCACCGGAAAACAACTTGATTCTGCCGTCGGAGCACAACGGGTTTCATCCATCCATCTATCACAACTGGCCGTTTTACGGATCAGAAGATTTGTTATCTGCTGCTGCCTCCGTCGTATCGGATGCGGTTTCAATTGAGACTACTCCTCATCAGATTATTCTTCCAAGACGTCGAAGCAATCGACAACATGATCAAGCGATAGATAACGGTGATGG...

CDS

Download CDS FASTA

651 bp · LXL04_020855|LXL04_020855|OH1004|CDS

ATGGAAGAAATGTATGGCTTCCACTCGACATCGGATTACACAATTTCACCGGAAAACAACTTGATTCTGCCGTCGGAGCACAACGGGTTTCATCCATCCATCTATCACAACTGGCCGTTTTACGGATCAGAAGATTTGTTATCTGCTGCTGCCTCCGTCGTATCGGATGCGGTTTCAATTGAGACTACTCCTCATCAGATTATTCTTCCAAGACGTCGAAGCAATCGACAACATGATCAAGCGATAGATAACGGTGATGG...

Protein

Download Protein FASTA

216 aa · LXL04_020855|LXL04_020855|OH1004|PROTEIN

MEEMYGFHSTSDYTISPENNLILPSEHNGFHPSIYHNWPFYGSEDLLSAAASVVSDAVSIETTPHQIILPRRRSNRQHDQAIDNGDGDESSGDTIKERIASHPSYFKLLDAYIDCQKVGAPPEIARLLDDIRLENDARKRNAKAASTCLGIDPELDEFMETYYHVLLKYKSDLERPFDEASFFFGNIKTQLRNLCKGAYTPSPSPNSSFLLNSIAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020855`
TK1151 ID	TkA05G318340
OH-1004 ID	LXL04_020855
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020855

Location Chr04:111508331-111509325 (-)

Description Similar to KNAT6: Homeobox protein knotted-1-like 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23380`	Plays a role in meristem function.	KNAT6: an Arabidopsis homeobox gene involved in meristem activity and organ separation.2006 · DOI: 10.1105/tpc.106.041988
`At1g70510`	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0302500`	Probable transcription factor that may be involved in shoot formation during early embryogenesis.	No verified direct reference in this release
`Os05g0129700`	Probable transcription factor that may be involved in shoot formation during embryogenesis.	No verified direct reference in this release
`UniProt: A2Y007`	Probable transcription factor that may be involved in shoot formation during embryogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020855 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010094 specification of carpel identity Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G23380

ath:AT1G70510

dosa:Os01g0302500

dosa:Os05g0129700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.711

Rank 1 · LXL04_020855 · OH-1004

Cytoplasm0.324

Rank 2 · LXL04_020855 · OH-1004

Cell membrane0.083

Rank 3 · LXL04_020855 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_020855 · OH-1004

Plastid0.028

Rank 5 · LXL04_020855 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03790.19KNOX195-135 aa

PF03791.19KNOX2149-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020855	`PF03790.19`	KNOX1	95	135	3.8e-18	65.7
LXL04_020855	`PF03791.19`	KNOX2	149	195	4.8e-21	74.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JS6`	Arabidopsis thaliana	Homeobox protein knotted-1-like 6	46.377%	Swiss-Prot	moderate database homology
`P46640`	Arabidopsis thaliana	Homeobox protein knotted-1-like 2	45.455%	Swiss-Prot	moderate database homology
`Q9FP29`	Oryza sativa subsp. japonica	Homeobox protein knotted-1-like 1	54.128%	Swiss-Prot	moderate database homology
`Q7GDL5`	Oryza sativa subsp. japonica	Homeobox protein knotted-1-like 10	52.066%	Swiss-Prot	moderate database homology
`A2Y007`	Oryza sativa subsp. indica	Homeobox protein knotted-1-like 10	52.066%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card