LXL04_020827 | RubberDandelionOmics

Gene overview

LXL04_020827

Reference: OH-1004 Chr: Chr04 Coordinates: 110605335-110610030 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2292 bp · LXL04_020827|LXL04_020827|OH1004|cDNA

ATGGACCTGAATGTGTTCTTCTTCTTATCATATGGGAAGGTTTTGGATGCCAATTTTATCTTGATTCAGTCCACAACAAACTCAAGGTATTTCTTTGAAACATTGTTCTTATTGGAAATGCCTCGCAAAGTATCATATGGAGTTGATTTTGATGAAGAGTATGATGCTTATGATGATTACCGtgatgattatgattataattatAACCATGGCAATGGTGTAGATGAACATGAACATGAACATGAACATGAAAATGCTTG...

CDS

Download CDS FASTA

2292 bp · LXL04_020827|LXL04_020827|OH1004|CDS

ATGGACCTGAATGTGTTCTTCTTCTTATCATATGGGAAGGTTTTGGATGCCAATTTTATCTTGATTCAGTCCACAACAAACTCAAGGTATTTCTTTGAAACATTGTTCTTATTGGAAATGCCTCGCAAAGTATCATATGGAGTTGATTTTGATGAAGAGTATGATGCTTATGATGATTACCGTGATGATTATGATTATAATTATAACCATGGCAATGGTGTAGATGAACATGAACATGAACATGAACATGAAAATGCTTG...

Protein

Download Protein FASTA

763 aa · LXL04_020827|LXL04_020827|OH1004|PROTEIN

MDLNVFFFLSYGKVLDANFILIQSTTNSRYFFETLFLLEMPRKVSYGVDFDEEYDAYDDYRDDYDYNYNHGNGVDEHEHEHEHENAWESPDVTITKQEIVQQNVWRCPICTYDNEEYMSACDICGVLRNPLIKSSNNGQSSTVDGVSMMAKSLFTSLPHGGGVNVNFQTDPQKDASSRKEDLQRNIRGQFHDLHNAIISEKHYKVNIAPFKFDTPSPDDVVSLGLQSYKLGSKVVSNLEKPSTSTTKKTENTTNLKSNAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020827`
TK1151 ID	TkA05G314700
OH-1004 ID	LXL04_020827
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 94.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_020827`
Location	Chr04:110605335-110610030 (+)
Description	Similar to HBS1L: HBS1-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020827` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0006417 regulation of translation Biological Process GO:0007165 signal transduction Biological Process GO:0032790 ribosome disassembly Biological Process GO:0070966 nuclear-transcribed mRNA catabolic process, no-go decay Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0070062 extracellular exosome Cellular Component GO:1990533 Dom34-Hbs1 complex Cellular Component
KEGG gene cross-reference	bta:541083 hsa:10767 mmu:56422 pon:100173449 rno:293408 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · LXL04_020827 · OH-1004

Nucleus0.263

Rank 2 · LXL04_020827 · OH-1004

Golgi apparatus0.121

Rank 3 · LXL04_020827 · OH-1004

Mitochondrion0.119

Rank 4 · LXL04_020827 · OH-1004

Endoplasmic reticulum0.117

Rank 5 · LXL04_020827 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009.34GTP_EFTU334-543 aa

PF03144.32GTP_EFTU_D2581-644 aa

PF03143.24GTP_EFTU_D3653-757 aa

PF22594.3GTP-eEF1A_C656-755 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020827	`PF00009.34`	GTP_EFTU	334	543	6.3e-48	163.6
LXL04_020827	`PF03144.32`	GTP_EFTU_D2	581	644	2.2e-08	35.1
LXL04_020827	`PF03143.24`	GTP_EFTU_D3	653	757	1.6e-10	41.9
LXL04_020827	`PF22594.3`	GTP-eEF1A_C	656	755	1.8e-27	96.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card