LXL04_020741 | RubberDandelionOmics

Gene overview

LXL04_020741

Reference: OH-1004 Chr: Chr04 Coordinates: 107423006-107424655 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · LXL04_020741|LXL04_020741|OH1004|cDNA

ATGGGCGGTGGTGGTCAAATGTCAAAACCCCCAATATGCAATAAAAATTTAGAACCACTCCGACGAGTCCCTTATGAAAAACCTCCATTCACCATTGGAGACCTTAAGAAAGCCATACCACCTCATTGTTTCAATCGATCAATCCCCCGCTCTTTCTCTTACCTCGTTCATGACCTAACTATTTCCTTCATCATCTACTACGTGGCCACCAAGTACATCCATATCCTCCCATACAACCTCTCATATGTAGCATGGCCTGT...

CDS

Download CDS FASTA

1374 bp · LXL04_020741|LXL04_020741|OH1004|CDS

ATGGGCGGTGGTGGTCAAATGTCAAAACCCCCAATATGCAATAAAAATTTAGAACCACTCCGACGAGTCCCTTATGAAAAACCTCCATTCACCATTGGAGACCTTAAGAAAGCCATACCACCTCATTGTTTCAATCGATCAATCCCCCGCTCTTTCTCTTACCTCGTTCATGACCTAACTATTTCCTTCATCATCTACTACGTGGCCACCAAGTACATCCATATCCTCCCATACAACCTCTCATATGTAGCATGGCCTGT...

Protein

Download Protein FASTA

457 aa · LXL04_020741|LXL04_020741|OH1004|PROTEIN

MGGGGQMSKPPICNKNLEPLRRVPYEKPPFTIGDLKKAIPPHCFNRSIPRSFSYLVHDLTISFIIYYVATKYIHILPYNLSYVAWPVYWILQGAFLGGVWVIAHECGHHAFSNYQWLDDTVGFLLHSFLLVPYFSWKYSHRHHHSNTNSLQLDEVYVPKFKSDVTSFLIYLNNPPGRVFHLIFMHALGWPLYLIFNYTGRNYDRFACHFDPNSPIYSKSERAQIFVSDVGILAVTYLIYHVAMNKGVSWVLCIYGVPMLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020741`
TK1151 ID	TkA05G300680
OH-1004 ID	LXL04_020741
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 99.738 / OH-1004 78.556 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020741

Location Chr04:107423006-107424655 (-)

Description Similar to FAD2: Delta(12) fatty acid desaturase FAD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12120`	ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes.	Consequences of omega -6-oleate desaturase deficiency on lipid dynamics and functional properties of mitochondrial membranes of Arabidopsis thaliana.2001 · DOI: 10.1074/jbc.m006231200 Desaturation and hydroxylation. Residues 148 and 324 of Arabidopsis FAD2, in addition to substrate chain length, exert a major influence in partitioning of catalytic specificity.2002 · DOI: 10.1074/jbc.m200231200 Alternative oxidase involvement in cold stress response of Arabidopsis thaliana fad2 and FAD3+ cell suspensions altered in membrane lipid composition.2007 · DOI: 10.1093/pcp/pcm061 Arabidopsis fatty acid desaturase FAD2 is required for salt tolerance during seed germination and early seedling growth.2012 · DOI: 10.1371/journal.pone.0030355 Arabidopsis FAD2 gene encodes the enzyme that is essential for polyunsaturated lipid synthesis.1994 · DOI: 10.1105/tpc.6.1.147 Functional expression of the extraplastidial Arabidopsis thaliana oleate desaturase gene (FAD2) in Saccharomyces cerevisiae.1996 · DOI: 10.1104/pp.111.1.223

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020741 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Molecular Function

GO:0045485 omega-6 fatty acid desaturase activity Molecular Function

GO:0050184 acyl-lipid omega-6 desaturase (cytochrome b5) activity Molecular Function

GO:0102985 acyl-CoA (9+3)-desaturase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12120

gmx:547815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.713

Rank 1 · LXL04_020741 · OH-1004

Golgi apparatus0.092

Rank 2 · LXL04_020741 · OH-1004

Cytoplasm0.076

Rank 3 · LXL04_020741 · OH-1004

Cell membrane0.074

Rank 4 · LXL04_020741 · OH-1004

Nucleus0.072

Rank 5 · LXL04_020741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11960.14DUF347427-63 aa

PF00487.31FA_desaturase84-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020741	`PF11960.14`	DUF3474	27	63	2.5e-06	28.5
LXL04_020741	`PF00487.31`	FA_desaturase	84	322	1.6e-24	87.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46313`	Arabidopsis thaliana	Delta(12)-fatty-acid desaturase	60.995%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card