LXL04_019840 | RubberDandelionOmics

Gene overview

LXL04_019840

Reference: OH-1004 Chr: Chr04 Coordinates: 41581884-41588472 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2679 bp · LXL04_019840|LXL04_019840|OH1004|cDNA

CACAAAATTAACGTGTTCTAATCTATATTTCAAGTTTTTTGTCTCGGTTACAAATTTTCTTCTTTGGACGATCAATGTTCATCATTATCATTAGAACATGAACACACACAACCAAATTCCTCACCAATTCTCGATAAGCTCCCACATATCGACATGACAACTCCAATCAAGCTTACAATTTTTTTCCTCTCGACATTTACTGTGTTCATACTATGTCCTCCATGTCGCGCTGCGGAAGAAATATCGGCAAAAAACGGGGC...

CDS

Download CDS FASTA

2616 bp · LXL04_019840|LXL04_019840|OH1004|CDS

TTGGACGATCAATGTTCATCATTATCATTAGAACATGAACACACACAACCAAATTCCTCACCAATTCTCGATAAGCTCCCACATATCGACATGACAACTCCAATCAAGCTTACAATTTTTTTCCTCTCGACATTTACTGTGTTCATACTATGTCCTCCATGTCGCGCTGCGGAAGAAATATCGGCAAAAAACGGGGCAATCCGTGATTCAAATCAAGAAACACTAATTTCTCCTGGAAAAGTATTTCAAATGGGATTCTT...

Protein

Download Protein FASTA

871 aa · LXL04_019840|LXL04_019840|OH1004|PROTEIN

MDDQCSSLSLEHEHTQPNSSPILDKLPHIDMTTPIKLTIFFLSTFTVFILCPPCRAAEEISAKNGAIRDSNQETLISPGKVFQMGFFELEPNQRYVGIWYYMDPKTIVWVANRDSPISSSSSMITIKDDGNLVVKDNSKNYFSTSLPSVPGSGNRTLKLLDTGNAVLTDASGNQVWSSFAFPTDTFLPGMYMEKTMKLTSWKTLNNPETGSFVFQKDQVFGYNNYTVFNGKSLHWKSGFGLEPNKNLTKIAIAALELLSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019840`
TK1151 ID	TkA05G094110
OH-1004 ID	LXL04_019840
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 97.539 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019840

Location Chr04:41581884-41588472 (+)

Description Similar to At4g03230: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At1g11340`	G-type lectin S-receptor-like serine/threonine-protein kinase RKS1.	No verified direct reference in this release
`At1g11330`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019840 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11330

ath:AT1G11340

ath:AT1G65800

ath:AT4G03230

ath:AT4G21390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.859

Rank 1 · LXL04_019840 · OH-1004

Endoplasmic reticulum0.083

Rank 2 · LXL04_019840 · OH-1004

Cytoplasm0.074

Rank 3 · LXL04_019840 · OH-1004

Nucleus0.040

Rank 4 · LXL04_019840 · OH-1004

Extracellular0.028

Rank 5 · LXL04_019840 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin106-201 aa

PF00954.26S_locus_glycop261-333 aa

PF00069.32Pkinase557-821 aa

PF07714.24PK_Tyr_Ser-Thr559-824 aa

PF11883.14DUF3403826-871 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019840	`PF01453.31`	B_lectin	106	201	8.6e-24	84.7
LXL04_019840	`PF00954.26`	S_locus_glycop	261	333	4.8e-15	56.8
LXL04_019840	`PF00069.32`	Pkinase	557	821	1.9e-43	149.5
LXL04_019840	`PF07714.24`	PK_Tyr_Ser-Thr	559	824	3.9e-49	168.0
LXL04_019840	`PF11883.14`	DUF3403	826	871	1.8e-08	35.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR08`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	45.105%	Swiss-Prot	moderate database homology
`Q9ZT07`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase RKS1	39.340%	Swiss-Prot	moderate database homology
`Q9SXB8`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330	38.876%	Swiss-Prot	moderate database homology
`Q9S972`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-6	39.197%	Swiss-Prot	moderate database homology
`O81906`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase B120	38.176%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card