LXL04_019549 | RubberDandelionOmics

Gene overview

LXL04_019549

Reference: OH-1004 Chr: Chr04 Coordinates: 33631855-33639034 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5097 bp · LXL04_019549|LXL04_019549|OH1004|cDNA

ATGTCGTCAGGGTCTCAAGCCCTAGGCGGCCAATCCCGCTGCGGATGGCTACTGGGGCCATCACTCGACAAGATCATAAAAAATGCTGCTTGGCGCAAACACTCTCACATCGTCGCTGCCTGCAAATCCGCCCTCGACAAGCTCGAAACCCTCACCGACGATTCTTCCGCATCAACTCCTCTATACGGCGTCGCCTCCGTCTCTGATGCCGAGTCCTTCATCCAGCCTCTCATCCTAGCCATTGATTCATCTTCCCCTAA...

CDS

Download CDS FASTA

5097 bp · LXL04_019549|LXL04_019549|OH1004|CDS

ATGTCGTCAGGGTCTCAAGCCCTAGGCGGCCAATCCCGCTGCGGATGGCTACTGGGGCCATCACTCGACAAGATCATAAAAAATGCTGCTTGGCGCAAACACTCTCACATCGTCGCTGCCTGCAAATCCGCCCTCGACAAGCTCGAAACCCTCACCGACGATTCTTCCGCATCAACTCCTCTATACGGCGTCGCCTCCGTCTCTGATGCCGAGTCCTTCATCCAGCCTCTCATCCTAGCCATTGATTCATCTTCCCCTAA...

Protein

Download Protein FASTA

1698 aa · LXL04_019549|LXL04_019549|OH1004|PROTEIN

MSSGSQALGGQSRCGWLLGPSLDKIIKNAAWRKHSHIVAACKSALDKLETLTDDSSASTPLYGVASVSDAESFIQPLILAIDSSSPKVVEPALDCSYRLFSLRLIRCEIDPSEHPHSIIFRLIDSICKCSGLGEEAVELAILKTLLAAVRSSTVLIRADCLNQIVKTCYNIYLGGVNGTNQICAKSVLAQMMAIIFARVEGDSLLVTFNTVSVTELLEFNDRNLNEGSSIQFVQNFINEVVFTNVVDADLNAKPLPELQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019549`
TK1151 ID	TkA05G062510
OH-1004 ID	LXL04_019549
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019549

Location Chr04:33631855-33639034 (-)

Description Similar to BIG1: Brefeldin A-inhibited guanine nucleotide-exchange protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38200`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At4g35380`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At3g60860`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At1g01960`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At3g43300`	Activates the ARF proteins by exchanging bound GDP for free GTP.	Effector-triggered immunity blocks pathogen degradation of an immunity-associated vesicle traffic regulator in Arabidopsis.2011 · DOI: 10.1073/pnas.1103338108

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019549 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006955 immune response Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031338 regulation of vesicle fusion Biological Process

GO:0032012 regulation of ARF protein signal transduction Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043001 Golgi to plasma membrane protein transport Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G01960

ath:AT3G43300

ath:AT3G60860

ath:AT4G35380

ath:AT4G38200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.482

Rank 1 · LXL04_019549 · OH-1004

Cytoplasm0.476

Rank 2 · LXL04_019549 · OH-1004

Endoplasmic reticulum0.133

Rank 3 · LXL04_019549 · OH-1004

Lysosome / Vacuole0.127

Rank 4 · LXL04_019549 · OH-1004

Cell membrane0.126

Rank 5 · LXL04_019549 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16213.12DCB24-201 aa

PF12783.14Sec7-like_HUS290-447 aa

PF01369.26Sec7559-740 aa

PF09324.16Sec7-like_HDS1113-1195 aa

PF16206.10Mon2_C1232-1356 aa

PF20252.4BIG2_C1496-1688 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019549	`PF16213.12`	DCB	24	201	1.4e-28	100.6
LXL04_019549	`PF12783.14`	Sec7-like_HUS	290	447	9.3e-41	140.1
LXL04_019549	`PF01369.26`	Sec7	559	740	1.9e-77	259.7
LXL04_019549	`PF09324.16`	Sec7-like_HDS	1113	1195	4.5e-32	110.5
LXL04_019549	`PF16206.10`	Mon2_C	1232	1356	4.9e-09	35.6
LXL04_019549	`PF20252.4`	BIG2_C	1496	1688	4.7e-30	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JSZ5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 1	63.979%	Swiss-Prot	strong database homology
`F4JN05`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 4	59.389%	Swiss-Prot	strong database homology
`Q9LZX8`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 2	48.554%	Swiss-Prot	moderate database homology
`Q9LPC5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 3	49.409%	Swiss-Prot	moderate database homology
`F4IXW2`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 5	35.137%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card