LXL04_019503 | RubberDandelionOmics

Gene overview

LXL04_019503

Reference: OH-1004 Chr: Chr04 Coordinates: 32730877-32734471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1791 bp · LXL04_019503|LXL04_019503|OH1004|cDNA

ATGGCAAATTCATCAGAACCATCATCATCAATAAGCTTCACCTCATCTTCCATCATATCCAATGCTTCATCTTCAATCCATGATCCACGCCCAAATCTTGAAATCGTTAGCTTAAATAAACTCAGCTCAAACTTAGAAAAGCTATTATCCGATCccaattccaattccaattccgATCCTGATTCCGATTCCAATTACAGCGATGCCGAAGTTGTTATCGATGGGATTCCCGTAGGCATTCATAGGTGTATTTTGGCTAG...

CDS

Download CDS FASTA

1791 bp · LXL04_019503|LXL04_019503|OH1004|CDS

ATGGCAAATTCATCAGAACCATCATCATCAATAAGCTTCACCTCATCTTCCATCATATCCAATGCTTCATCTTCAATCCATGATCCACGCCCAAATCTTGAAATCGTTAGCTTAAATAAACTCAGCTCAAACTTAGAAAAGCTATTATCCGATCCCAATTCCAATTCCAATTCCGATCCTGATTCCGATTCCAATTACAGCGATGCCGAAGTTGTTATCGATGGGATTCCCGTAGGCATTCATAGGTGTATTTTGGCTAG...

Protein

Download Protein FASTA

596 aa · LXL04_019503|LXL04_019503|OH1004|PROTEIN

MANSSEPSSSISFTSSSIISNASSSIHDPRPNLEIVSLNKLSSNLEKLLSDPNSNSNSDPDSDSNYSDAEVVIDGIPVGIHRCILASRSKFFSDLFKENKGCVEKDGKPKYIMSELLPYGNVGYDAFLVFLSYIYTGKLRSSPPEVSTCVDDMCLHDACRPAINFAVELTYAASVFLIPELVSLFQRRLLNFIDKALVEDVIPILVVAFQCQLQQVLTPCIDRVSRSNLDNICLQKEVPFEVSQNIKSIRNPENEHTVES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019503`
TK1151 ID	TkAUNG071970
OH-1004 ID	LXL04_019503
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 97.785 / OH-1004 96.309 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019503

Location Chr04:32730877-32734471 (+)

Description Similar to NPR1: BTB/POZ domain and ankyrin repeat-containing protein NPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45110`	Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of NPR1 in response to SA.	Negative regulation of defense responses in Arabidopsis by two NPR1 paralogs.2006 · DOI: 10.1111/j.1365-313x.2006.02903.x NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants.2012 · DOI: 10.1038/nature11162
`At4g19660`	Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of NPR1 in the absence of SA.	An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance.2005 · DOI: 10.1111/j.1365-313x.2004.02296.x Negative regulation of defense responses in Arabidopsis by two NPR1 paralogs.2006 · DOI: 10.1111/j.1365-313x.2006.02903.x NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants.2012 · DOI: 10.1038/nature11162 Structural basis of salicylic acid perception by Arabidopsis NPR proteins.2020 · DOI: 10.1038/s41586-020-2596-y

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0767900`	Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility.2007 · DOI: 10.1111/j.1467-7652.2007.00243.x
`Os03g0667100`	Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility.2007 · DOI: 10.1111/j.1467-7652.2007.00243.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019503 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0010112 regulation of systemic acquired resistance Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT4G19660

ath:AT5G45110

dosa:Os01g0767900

dosa:Os03g0667100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455

Rank 1 · LXL04_019503 · OH-1004

Nucleus0.357

Rank 2 · LXL04_019503 · OH-1004

Cell membrane0.149

Rank 3 · LXL04_019503 · OH-1004

Golgi apparatus0.080

Rank 4 · LXL04_019503 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_019503 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB64-142 aa

PF11900.15DUF3420228-273 aa

PF12796.14Ank_2273-355 aa

PF12313.14NPR1_like_C372-572 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019503	`PF00651.38`	BTB	64	142	5.7e-09	36.8
LXL04_019503	`PF11900.15`	DUF3420	228	273	4.7e-07	30.5
LXL04_019503	`PF12796.14`	Ank_2	273	355	4.2e-08	34.4
LXL04_019503	`PF12313.14`	NPR1_like_C	372	572	1.3e-88	296.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L746`	Arabidopsis thaliana	Regulatory protein NPR3	58.505%	Swiss-Prot	strong database homology
`Q5ICL9`	Arabidopsis thaliana	Regulatory protein NPR4	57.598%	Swiss-Prot	strong database homology
`Q0JJ01`	Oryza sativa subsp. japonica	BTB/POZ domain and ankyrin repeat-containing protein NPR2	55.935%	Swiss-Prot	strong database homology
`Q75HA6`	Oryza sativa subsp. japonica	BTB/POZ domain and ankyrin repeat-containing protein NPR3	51.927%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card