LXL04_019456 | RubberDandelionOmics

Gene overview

LXL04_019456

Reference: OH-1004 Chr: Chr04 Coordinates: 31670487-31672573 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1817 bp · LXL04_019456|LXL04_019456|OH1004|cDNA

ATGAAATTGAAATACGCTCCTTCctttctctttcttcttttctctcTCTTGGTTACCGTTAAGCCAGACCTCTCCGTCGACAGATCAGCCATCCTCGCCATCCGTTCCTCCGTCGGTGGCCGGTCCATACTCTGGAACATCTCTCAACCCGCCACACCATGCACATGGCCAGGCGTCGTCTGCGACACCAAAATAAACCGCGTCGTGGAGCTCCATTTCCCCGGAATGGGTCTCTCCGGCGAACTCCCATCAAATACACT...

CDS

Download CDS FASTA

1767 bp · LXL04_019456|LXL04_019456|OH1004|CDS

ATGAAATTGAAATACGCTCCTTCCTTTCTCTTTCTTCTTTTCTCTCTCTTGGTTACCGTTAAGCCAGACCTCTCCGTCGACAGATCAGCCATCCTCGCCATCCGTTCCTCCGTCGGTGGCCGGTCCATACTCTGGAACATCTCTCAACCCGCCACACCATGCACATGGCCAGGCGTCGTCTGCGACACCAAAATAAACCGCGTCGTGGAGCTCCATTTCCCCGGAATGGGTCTCTCCGGCGAACTCCCATCAAATACACT...

Protein

Download Protein FASTA

588 aa · LXL04_019456|LXL04_019456|OH1004|PROTEIN

MKLKYAPSFLFLLFSLLVTVKPDLSVDRSAILAIRSSVGGRSILWNISQPATPCTWPGVVCDTKINRVVELHFPGMGLSGELPSNTLGNLTQLTTLSIRYNALSGQLPVDIFSLTNLRNLYLQDNLFSGPIPDLFSPLGNLVRVSFAGNNFSGPIPYSVNNLTRLAKFDVSNNQLTGEIPSKFVDFPVSAFSGNSLCGRPLVACNGSETSSSSSSKLSGGAIAGIVIGSLFIFLLISYIFFLCCKKRNQNDEMKSKDLGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019456`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019456

Location Chr04:31670487-31672573 (-)

Description Similar to RKL1: Probable inactive receptor kinase At1g48480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48480`	Probable inactive receptor kinase At1g48480.	No verified direct reference in this release
`At3g17840`	Probable inactive receptor kinase RLK902.	No verified direct reference in this release
`At5g16590`	Might be involved in early recognition of growth promoting fungi.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At3g02880`	Probable inactive receptor kinase At3g02880.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019456 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0022898 regulation of transmembrane transporter activity Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G48480

ath:AT2G26730

ath:AT3G02880

ath:AT3G17840

ath:AT5G16590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.890

Rank 1 · LXL04_019456 · OH-1004

Endoplasmic reticulum0.071

Rank 2 · LXL04_019456 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_019456 · OH-1004

Nucleus0.049

Rank 4 · LXL04_019456 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_019456 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_226-62 aa

PF13855.13LRR_882-126 aa

PF07714.24PK_Tyr_Ser-Thr324-582 aa

PF00069.32Pkinase324-579 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019456	`PF08263.18`	LRRNT_2	26	62	3.8e-06	27.8
LXL04_019456	`PF13855.13`	LRR_8	82	126	1e-06	29.1
LXL04_019456	`PF07714.24`	PK_Tyr_Ser-Thr	324	582	1.4e-33	117.1
LXL04_019456	`PF00069.32`	Pkinase	324	579	8.3e-32	111.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LP77`	Arabidopsis thaliana	Probable inactive receptor kinase At1g48480	52.674%	Swiss-Prot	strong database homology
`Q9LVI6`	Arabidopsis thaliana	Probable inactive receptor kinase RLK902	52.846%	Swiss-Prot	strong database homology
`Q9FMD7`	Arabidopsis thaliana	Probable inactive receptor kinase At5g16590	50.571%	Swiss-Prot	strong database homology
`Q9M8T0`	Arabidopsis thaliana	Probable inactive receptor kinase At3g02880	50.080%	Swiss-Prot	strong database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	46.440%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card