LXL04_019280 | RubberDandelionOmics

Gene overview

LXL04_019280

Reference: OH-1004 Chr: Chr04 Coordinates: 27981534-27982064 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · LXL04_019280|LXL04_019280|OH1004|cDNA

ATGACAACTTTCCACGCTCGCAGTCTTCTCGATGGGCCGTTTGTTCCTTCACCACACCACAACGATACAGCAAGTTCAAGTGAGACGAATCTAATAGTCAATATTATGTGGATCGTCTTGCTATGTGGATTAATAGCCTCTTTTGGAGTGTTTCAAGTGATACGTTATGTTATGCAACGAAGACGTACATCCAACCCGACAACACAAACATCAGAACACGAACCACAACCCGAACCTTGTGTTGGTCTTAAGAAATCCGT...

CDS

Download CDS FASTA

531 bp · LXL04_019280|LXL04_019280|OH1004|CDS

ATGACAACTTTCCACGCTCGCAGTCTTCTCGATGGGCCGTTTGTTCCTTCACCACACCACAACGATACAGCAAGTTCAAGTGAGACGAATCTAATAGTCAATATTATGTGGATCGTCTTGCTATGTGGATTAATAGCCTCTTTTGGAGTGTTTCAAGTGATACGTTATGTTATGCAACGAAGACGTACATCCAACCCGACAACACAAACATCAGAACACGAACCACAACCCGAACCTTGTGTTGGTCTTAAGAAATCCGT...

Protein

Download Protein FASTA

176 aa · LXL04_019280|LXL04_019280|OH1004|PROTEIN

MTTFHARSLLDGPFVPSPHHNDTASSSETNLIVNIMWIVLLCGLIASFGVFQVIRYVMQRRRTSNPTTQTSEHEPQPEPCVGLKKSVVAQISTRVLGSILKISVTECSICLEDFVDGQNVRVLPHCCHEFHIECIDRWFESHSSCPNCRNSLLENQVDSHVVVPESVVNTSNEDMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019280`
TK1151 ID	TkA05G037320
OH-1004 ID	LXL04_019280
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.114 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019280

Location Chr04:27981534-27982064 (+)

Description Similar to ATL73: RING-H2 finger protein ATL73

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05280`	RING-H2 finger protein ATL73.	No verified direct reference in this release
`At3g10910`	RING-H2 finger protein ATL72.	No verified direct reference in this release
`At2g17450`	E3 ubiquitin-protein ligase that possess E3 ubiquitin ligase activity in vitro and mediates protein monoubiquitination.	Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3
`At1g20823`	May be involved in the early steps of the plant defense signaling pathway.	No verified direct reference in this release
`At5g01880`	RING-H2 finger protein ATL74.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019280 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006513 protein monoubiquitination Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010966 regulation of phosphate transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0048443 stamen development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G20823

ath:AT2G17450

ath:AT3G10910

ath:AT5G01880

ath:AT5G05280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.332

Rank 1 · LXL04_019280 · OH-1004

Endoplasmic reticulum0.261

Rank 2 · LXL04_019280 · OH-1004

Cell membrane0.222

Rank 3 · LXL04_019280 · OH-1004

Cytoplasm0.210

Rank 4 · LXL04_019280 · OH-1004

Golgi apparatus0.163

Rank 5 · LXL04_019280 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2106-149 aa

PF17123.12zf-RING_11106-135 aa

PF13923.13zf-C3HC4_2106-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019280	`PF13639.13`	zf-RING_2	106	149	3.5e-14	53.5
LXL04_019280	`PF17123.12`	zf-RING_11	106	135	2.1e-10	40.8
LXL04_019280	`PF13923.13`	zf-C3HC4_2	106	148	8.9e-07	29.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLC6`	Arabidopsis thaliana	RING-H2 finger protein ATL73	41.606%	Swiss-Prot	moderate database homology
`Q9SG96`	Arabidopsis thaliana	RING-H2 finger protein ATL72	38.095%	Swiss-Prot	moderate database homology
`O22755`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ATL44	35.526%	Swiss-Prot	moderate database homology
`Q9LM69`	Arabidopsis thaliana	RING-H2 finger protein ATL80	37.241%	Swiss-Prot	moderate database homology
`Q9LZV8`	Arabidopsis thaliana	RING-H2 finger protein ATL74	55.128%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card