LXL04_018947 | RubberDandelionOmics

Gene overview

LXL04_018947

Reference: OH-1004 Chr: Chr04 Coordinates: 20318264-20318638 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · LXL04_018947|LXL04_018947|OH1004|cDNA

ATGGCAACGATGGCTGGTGCTAGCCTCTCCATCCCCCGGGTTATAGCCAGCCCATCATCAGACTCGCCCAAGGTCCTTAGTGGGCTAAAATCCGTGAAGATGCCAACAAGGATGAACTCAGGAAGGGTGTATTTGATGCCGGTGAGGGCGGCGCCTGAAAGCTTGTCGGACAAGATAGCCTCCAGCATCGAGAGCGCCAAGGAGTCGTGTGCAGATGACCCTGTCAGCGGTGAGTGTGTGGCGGCGTGGGATGAGGTGGA...

CDS

Download CDS FASTA

375 bp · LXL04_018947|LXL04_018947|OH1004|CDS

ATGGCAACGATGGCTGGTGCTAGCCTCTCCATCCCCCGGGTTATAGCCAGCCCATCATCAGACTCGCCCAAGGTCCTTAGTGGGCTAAAATCCGTGAAGATGCCAACAAGGATGAACTCAGGAAGGGTGTATTTGATGCCGGTGAGGGCGGCGCCTGAAAGCTTGTCGGACAAGATAGCCTCCAGCATCGAGAGCGCCAAGGAGTCGTGTGCAGATGACCCTGTCAGCGGTGAGTGTGTGGCGGCGTGGGATGAGGTGGA...

Protein

Download Protein FASTA

124 aa · LXL04_018947|LXL04_018947|OH1004|PROTEIN

MATMAGASLSIPRVIASPSSDSPKVLSGLKSVKMPTRMNSGRVYLMPVRAAPESLSDKIASSIESAKESCADDPVSGECVAAWDEVEELSAASSHARDKAKDTDPLEAYCKDNPETDECRTYED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018947`
TK1151 ID	TkA05G005150
OH-1004 ID	LXL04_018947
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018947

Location Chr04:20318264-20318638 (-)

Description Similar to CP12-2: Calvin cycle protein CP12-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62410`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008
`At2g47400`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008
`At1g76560`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018947 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009744 response to sucrose Biological Process

GO:0018316 peptide cross-linking via L-cystine Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071454 cellular response to anoxia Biological Process

GO:0080153 negative regulation of reductive pentose-phosphate cycle Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G76560

ath:AT2G47400

ath:AT3G62410

cre:CHLRE_08g380250v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · LXL04_018947 · OH-1004

Mitochondrion0.019

Rank 2 · LXL04_018947 · OH-1004

Nucleus0.017

Rank 3 · LXL04_018947 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_018947 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_018947 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02672.21CP1255-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018947	`PF02672.21`	CP12	55	123	3.6e-25	89.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZP9`	Arabidopsis thaliana	Calvin cycle protein CP12-2, chloroplastic	53.788%	Swiss-Prot	strong database homology
`O22914`	Arabidopsis thaliana	Calvin cycle protein CP12-1, chloroplastic	53.488%	Swiss-Prot	strong database homology
`Q9C9K2`	Arabidopsis thaliana	Calvin cycle protein CP12-3, chloroplastic	48.148%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card