LXL04_018461 | RubberDandelionOmics

Gene overview

LXL04_018461

Reference: OH-1004 Chr: Chr04 Coordinates: 13313744-13314271 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_018461|LXL04_018461|OH1004|cDNA

GACATTCTCTCCACTATAAACACACCCCACAAATCCCAAATACACTTTCAAAACTTCTCCCCAGCTTTACCTTCCTCATCTAATCTTCCCCACATAAACATGTCTCTTGGCAAAGACAACATGAACCCCATTCCCATACATAACGACACCATCCATGATGGCATGGTGATGCACATGAGTTTCTTTTGGAGCAAAGATGTTGTGATGTTAATCAACGGTTGGCCAAACGGGAAACTAGTTTTTCCGGTCATCAAGAATGG...

CDS

Download CDS FASTA

366 bp · LXL04_018461|LXL04_018461|OH1004|CDS

ATGTCTCTTGGCAAAGACAACATGAACCCCATTCCCATACATAACGACACCATCCATGATGGCATGGTGATGCACATGAGTTTCTTTTGGAGCAAAGATGTTGTGATGTTAATCAACGGTTGGCCAAACGGGAAACTAGTTTTTCCGGTCATCAAGAATGGGTGTAGTCCGGTTATTGGTGGATTGATCCATGCTTCGCTTTATGGGCTACGAATGGCTCTTGTTTATGTTGTTATGTTGTGTGTCATGTCATATAATGT...

Protein

Download Protein FASTA

121 aa · LXL04_018461|LXL04_018461|OH1004|PROTEIN

MSLGKDNMNPIPIHNDTIHDGMVMHMSFFWSKDVVMLINGWPNGKLVFPVIKNGCSPVIGGLIHASLYGLRMALVYVVMLCVMSYNVGVFVFVVAGHVIGCFLVKYWMISRAASKSRTDPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018461`
TK1151 ID	TkA08G062710
OH-1004 ID	LXL04_018461
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 47.000 / OH-1004 38.843 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018461

Location Chr04:13313744-13314271 (-)

Description Similar to COPT3: Copper transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59040`	Involved in the transport of copper.	No verified direct reference in this release
`At2g26975`	Involved in the transport of copper.	No verified direct reference in this release
`At3g46900`	Involved in the transport of copper.	Identification of a copper transporter family in Arabidopsis thaliana.2003 · DOI: 10.1023/a:1022345507112
`At5g59030`	Copper transporter involved in copper acquisition and transport in leaves.	Identification of a copper transporter family in Arabidopsis thaliana.2003 · DOI: 10.1023/a:1022345507112 The Arabidopsis copper transporter COPT1 functions in root elongation and pollen development.2004 · DOI: 10.1074/jbc.m313321200 Molecular characterization of a putative Arabidopsis thaliana copper transporter and its yeast homologue.1995 · DOI: 10.1074/jbc.270.47.28479

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0415600`	Involved in the transport of copper.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018461 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006825 copper ion transport Biological Process

GO:0035434 copper ion transmembrane transport Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0048364 root development Biological Process

GO:0098705 copper ion import across plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005375 copper ion transmembrane transporter activity Molecular Function

GO:0015089 high-affinity copper ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G26975

ath:AT3G46900

ath:AT5G59030

ath:AT5G59040

dosa:Os04g0415600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.525

Rank 1 · LXL04_018461 · OH-1004

Golgi apparatus0.167

Rank 2 · LXL04_018461 · OH-1004

Cytoplasm0.138

Rank 3 · LXL04_018461 · OH-1004

Lysosome / Vacuole0.122

Rank 4 · LXL04_018461 · OH-1004

Nucleus0.110

Rank 5 · LXL04_018461 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04145.21Ctr62-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018461	`PF04145.21`	Ctr	62	103	2e-08	35.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGU8`	Arabidopsis thaliana	Copper transporter 3	35.246%	Swiss-Prot	moderate database homology
`Q8GWP3`	Arabidopsis thaliana	Copper transporter 6	31.624%	Swiss-Prot	moderate database homology
`Q9STG2`	Arabidopsis thaliana	Copper transporter 2	29.204%	Swiss-Prot	weak database homology
`Q39065`	Arabidopsis thaliana	Copper transporter 1	29.412%	Swiss-Prot	weak database homology
`Q7XTF8`	Oryza sativa subsp. japonica	Copper transporter 6	30.833%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card