LXL04_018316 | RubberDandelionOmics

Gene overview

LXL04_018316

Reference: OH-1004 Chr: Chr04 Coordinates: 11421458-11427259 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1581 bp · LXL04_018316|LXL04_018316|OH1004|cDNA

ATGTACCTTAGATACGATCGAAACAGCGAATCGATTCGAAAGAAAGAAGCAAGCTTTTTGACGGAAGGTGCACGTCGGAAGGTTTTGCTTTTGACGAAAAGagaccaccggaccaccacctacacccaccggaccaccacctgcacccaccaccggaccaccgccggaccaccgtcggtgcaccacctgcacccatcggcacattggaccactgatgcaccaccgccggaccaccgccggaccaccgccgtaccaccgcc...

CDS

Download CDS FASTA

1581 bp · LXL04_018316|LXL04_018316|OH1004|CDS

ATGTACCTTAGATACGATCGAAACAGCGAATCGATTCGAAAGAAAGAAGCAAGCTTTTTGACGGAAGGTGCACGTCGGAAGGTTTTGCTTTTGACGAAAAGAGACCACCGGACCACCACCTACACCCACCGGACCACCACCTGCACCCACCACCGGACCACCGCCGGACCACCGTCGGTGCACCACCTGCACCCATCGGCACATTGGACCACTGATGCACCACCGCCGGACCACCGCCGGACCACCGCCGTACCACCGCC...

Protein

Download Protein FASTA

526 aa · LXL04_018316|LXL04_018316|OH1004|PROTEIN

MYLRYDRNSESIRKKEASFLTEGARRKVLLLTKRDHRTTTYTHRTTTCTHHRTTAGPPSVHHLHPSAHWTTDAPPPDHRRTTAVPPPDHRIRIQTIKHRISHEIDRHEDEDNPTALNPSSIAGDGQSRNSGGSRTRTSSCTKEEVDAILIQCGRFSRSNSAGSQNPNRRRRYSRSNTSYDFDLDTSLKNDDGDDENDEAMNNHHRHREENPTCERSSATLERTSPERGSGRWRGRRRGRRRWRGSRRCEVAGEVDGRSNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018316`
TK1151 ID	TkA08G005960
OH-1004 ID	LXL04_018316
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 93.015 / OH-1004 48.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018316

Location Chr04:11421458-11427259 (-)

Description Similar to D14: Strigolactone esterase D14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03990`	Involved in strigolactone signaling pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0203200`	Involved in strigolactone (SL) signaling pathway.	Identification and characterization of HTD2: a novel gene negatively regulating tiller bud outgrowth in rice.2009 · DOI: 10.1007/s00425-009-0975-6

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010223 secondary shoot formation Biological Process

GO:1901601 strigolactone biosynthetic process Biological Process

GO:1902347 response to strigolactone Biological Process

GO:1902348 cellular response to strigolactone Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT3G03990

dosa:Os03g0203200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · LXL04_018316 · OH-1004

Nucleus0.464

Rank 2 · LXL04_018316 · OH-1004

Cell membrane0.120

Rank 3 · LXL04_018316 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_018316 · OH-1004

Lysosome / Vacuole0.039

Rank 5 · LXL04_018316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30950.1At1g6571093-255 aa

PF00561.27Abhydrolase_1278-512 aa

PF12697.14Abhydrolase_6279-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018316	`PF30950.1`	At1g65710	93	255	8.6e-24	85.1
LXL04_018316	`PF00561.27`	Abhydrolase_1	278	512	8.8e-19	68.8
LXL04_018316	`PF12697.14`	Abhydrolase_6	279	515	9.9e-11	43.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQR3`	Arabidopsis thaliana	Strigolactone esterase D14	43.028%	Swiss-Prot	weak database homology
`Q10QA5`	Oryza sativa subsp. japonica	Strigolactone esterase D14	41.833%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card