LXL04_018179 | RubberDandelionOmics

Gene overview

LXL04_018179

Reference: OH-1004 Chr: Chr04 Coordinates: 8091586-8093123 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

291 bp · LXL04_018179|LXL04_018179|OH1004|cDNA

ATGTCATGCATAAACGAGGtagagatgagaggtccgtatgtctcatccacggaatcagctcgggcctggagctgggctatctggtggcgaatctcgcccatggtctccccaggaccaTGGCATAGATGGACAGGAAGATTTGAAGCACATCTATGGGACAAGGGTACATGGAACAACATCCGGAACAAGAAAGGGAAAAAAAGGGCATATGATAGTGAAGAGGCTGCTGCTCGTACCTACGATCTTGCGGCCCTTAACTA...

CDS

Download CDS FASTA

291 bp · LXL04_018179|LXL04_018179|OH1004|CDS

ATGTCATGCATAAACGAGGTAGAGATGAGAGGTCCGTATGTCTCATCCACGGAATCAGCTCGGGCCTGGAGCTGGGCTATCTGGTGGCGAATCTCGCCCATGGTCTCCCCAGGACCATGGCATAGATGGACAGGAAGATTTGAAGCACATCTATGGGACAAGGGTACATGGAACAACATCCGGAACAAGAAAGGGAAAAAAAGGGCATATGATAGTGAAGAGGCTGCTGCTCGTACCTACGATCTTGCGGCCCTTAACTA...

Protein

Download Protein FASTA

96 aa · LXL04_018179|LXL04_018179|OH1004|PROTEIN

MSCINEVEMRGPYVSSTESARAWSWAIWWRISPMVSPGPWHRWTGRFEAHLWDKGTWNNIRNKKGKKRAYDSEEAAARTYDLAALNYQWKVFEIDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018179`
TK1151 ID	TkA08G022110
OH-1004 ID	LXL04_018179
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.900
Protein coverage (%)	TK1151 63.462 / OH-1004 68.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018179

Location Chr04:8091586-8093123 (-)

Description Similar to WRI1: Ethylene-responsive transcription factor WRI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54320`	May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).	Contrapuntal networks of gene expression during Arabidopsis seed filling.2002 · DOI: 10.1105/tpc.000877 WRINKLED1 encodes an AP2/EREB domain protein involved in the control of storage compound biosynthesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02235.x ACTIVATOR of Spomin::LUC1/WRINKLED1 of Arabidopsis thaliana transactivates sugar-inducible promoters.2005 · DOI: 10.1093/pcp/pci072 A spatiotemporal analysis of enzymatic activities associated with carbon metabolism in wild-type and mutant embryos of Arabidopsis using in situ histochemistry.2006 · DOI: 10.1111/j.1365-313x.2006.02682.x WRI1 is required for seed germination and seedling establishment.2006 · DOI: 10.1104/pp.106.079574 wrinkled1: A novel, low-seed-oil mutant of Arabidopsis with a deficiency in the seed-specific regulation of carbohydrate metabolism.1998 · DOI: 10.1104/pp.118.1.91
`At5g10510`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g37750`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CAC[AG]N[AT]TNCCNANG-3'.	No verified direct reference in this release
`At5g65510`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0124700`	Acts as a positive regulator of adventitious (crown) root formation by promoting its initiation.	The auxin responsive AP2/ERF transcription factor CROWN ROOTLESS5 is involved in crown root initiation in rice through the induction of OsRR1, a type-A response regulator of cytokinin signaling.2011 · DOI: 10.1111/j.1365-313x.2011.04610.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018179 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0007276 gamete generation Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010080 regulation of floral meristem growth Biological Process

GO:0010311 lateral root formation Biological Process

KEGG gene cross-reference

ath:AT3G54320

ath:AT4G37750

ath:AT5G10510

ath:AT5G65510

dosa:Os07g0124700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.373

Rank 1 · LXL04_018179 · OH-1004

Cytoplasm0.316

Rank 2 · LXL04_018179 · OH-1004

Extracellular0.101

Rank 3 · LXL04_018179 · OH-1004

Mitochondrion0.100

Rank 4 · LXL04_018179 · OH-1004

Plastid0.079

Rank 5 · LXL04_018179 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6X5Y6`	Arabidopsis thaliana	Ethylene-responsive transcription factor WRI1	78.000%	Swiss-Prot	weak database homology
`Q52QU2`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor AIL6	57.447%	Swiss-Prot	weak database homology
`Q38914`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor ANT	56.000%	Swiss-Prot	weak database homology
`Q6J9N8`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor AIL7	54.000%	Swiss-Prot	weak database homology
`Q84Z02`	Oryza sativa subsp. japonica	AP2-like ethylene-responsive transcription factor CRL5	59.574%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card