LXL04_018092 | RubberDandelionOmics

Gene overview

LXL04_018092

Reference: OH-1004 Chr: Chr04 Coordinates: 6520722-6522616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

794 bp · LXL04_018092|LXL04_018092|OH1004|cDNA

ATGGGGATAGTGGGTGAATACAAGAGAAGGTATGCATTACTTCTAGCAGCAAGAGACTCAGAGTATGTGAAGAAGGTGTACGGAGGGTATTTTAATGTATTTTTCGCAGCTTTTGGCGAAGAGGAAGAAGAGAGGTGGGATTTGTATAGGGTAGTTGATGGGGAATTTCCTGACATGAATGAGCTTCAAGATTATGATGGGTTTGTAGTGAGTGGAAGTCCGTATGATTCTTATGGAGATGACGATTGGATTCTCGAGCT...

CDS

Download CDS FASTA

759 bp · LXL04_018092|LXL04_018092|OH1004|CDS

ATGGGGATAGTGGGTGAATACAAGAGAAGGTATGCATTACTTCTAGCAGCAAGAGACTCAGAGTATGTGAAGAAGGTGTACGGAGGGTATTTTAATGTATTTTTCGCAGCTTTTGGCGAAGAGGAAGAAGAGAGGTGGGATTTGTATAGGGTAGTTGATGGGGAATTTCCTGACATGAATGAGCTTCAAGATTATGATGGGTTTGTAGTGAGTGGAAGTCCGTATGATTCTTATGGAGATGACGATTGGATTCTCGAGCT...

Protein

Download Protein FASTA

252 aa · LXL04_018092|LXL04_018092|OH1004|PROTEIN

MGIVGEYKRRYALLLAARDSEYVKKVYGGYFNVFFAAFGEEEEERWDLYRVVDGEFPDMNELQDYDGFVVSGSPYDSYGDDDWILELCFLLQTLDSMQKKVLGICFGHQVLCRALGGRVGKSQSGWDIGLRKVKILKDFSPSNFLESLTEMPPPLSIIECHQDEVLEVPMGAEVIAYSDKTGVEMFTIGDHILGIQGHPEYSKDILNNLIDRLLNQDDIDIGFAEDVRAKLESAEPDTKCWQELCKAFLKGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018092`
TK1151 ID	TkA08G027260
OH-1004 ID	LXL04_018092
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 90.947 / OH-1004 87.698 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018092

Location Chr04:6520722-6522616 (+)

Description Similar to GGP3: Gamma-glutamyl peptidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30550`	Involved in glucosinolate biosynthesis.	Cytosolic γ-glutamyl peptidases process glutathione conjugates in the biosynthesis of glucosinolates and camalexin in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083998
`At2g23970`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release
`At4g30530`	Involved in glucosinolate biosynthesis.	Cytosolic γ-glutamyl peptidases process glutathione conjugates in the biosynthesis of glucosinolates and camalexin in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083998
`At4g30540`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release
`At2g23960`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018092 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0008233 peptidase activity Molecular Function

GO:0034722 gamma-glutamyl-peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G23960

ath:AT2G23970

ath:AT4G30530

ath:AT4G30540

ath:AT4G30550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_018092 · OH-1004

Nucleus0.445

Rank 2 · LXL04_018092 · OH-1004

Mitochondrion0.060

Rank 3 · LXL04_018092 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_018092 · OH-1004

Peroxisome0.049

Rank 5 · LXL04_018092 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117.35GATase60-202 aa

PF04204.23HTS61-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018092	`PF00117.35`	GATase	60	202	1.8e-15	57.9
LXL04_018092	`PF04204.23`	HTS	61	216	2.8e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0A5`	Arabidopsis thaliana	Gamma-glutamyl peptidase 3	55.020%	Swiss-Prot	strong database homology
`O82225`	Arabidopsis thaliana	Gamma-glutamyl peptidase 5	56.735%	Swiss-Prot	strong database homology
`Q9M0A7`	Arabidopsis thaliana	Gamma-glutamyl peptidase 1	49.796%	Swiss-Prot	moderate database homology
`Q9M0A6`	Arabidopsis thaliana	Gamma-glutamyl peptidase 2	50.820%	Swiss-Prot	strong database homology
`F4INN2`	Arabidopsis thaliana	Gamma-glutamyl peptidase 4	50.820%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card