LXL04_017283 | RubberDandelionOmics

Gene overview

LXL04_017283

Reference: OH-1004 Chr: Chr03 Coordinates: 145058346-145060567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · LXL04_017283|LXL04_017283|OH1004|cDNA

ATGGCTTCAAACCACCATCTCAAAAGACCTAATCAACTATCTTCTTCCTCTACAATCTACTTCTACATCTTCGTTTCCATCATCGCCCTCGCCGCTCTTTTTCTCCTCTCCTCTCACTACCTCACCTCTTACTCCACGGCTCCGATGCGTGTTGTATCACTCAAACCGATCAAGCAATACGACGACAGTGGAGCTGCATCAGCAACATGCGATTACTCAGAGGGCAAGTGGTTCTACGATCCGACAGTCAGACCTCCTCG...

CDS

Download CDS FASTA

1263 bp · LXL04_017283|LXL04_017283|OH1004|CDS

ATGGCTTCAAACCACCATCTCAAAAGACCTAATCAACTATCTTCTTCCTCTACAATCTACTTCTACATCTTCGTTTCCATCATCGCCCTCGCCGCTCTTTTTCTCCTCTCCTCTCACTACCTCACCTCTTACTCCACGGCTCCGATGCGTGTTGTATCACTCAAACCGATCAAGCAATACGACGACAGTGGAGCTGCATCAGCAACATGCGATTACTCAGAGGGCAAGTGGTTCTACGATCCGACAGTCAGACCTCCTCG...

Protein

Download Protein FASTA

420 aa · LXL04_017283|LXL04_017283|OH1004|PROTEIN

MASNHHLKRPNQLSSSSTIYFYIFVSIIALAALFLLSSHYLTSYSTAPMRVVSLKPIKQYDDSGAASATCDYSEGKWFYDPTVRPPRYDETCKEIYKGWNCVAGNRSGAAEIVKWRWQPNHCALPQFDPLRFLESHRDISIGFVGDSLNRNMFVSLFCSLRHVTTEVKKWRPAGADRAFTFLNYNLTIAYHRTNLLARYGRWSANPKGGELESLGYKEGYRVDVDIPEATWADAPSFHNILIFNTGHWWWAPSKFDPVKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017283`
TK1151 ID	TkA02G060350
OH-1004 ID	LXL04_017283
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017283

Location Chr03:145058346-145060567 (+)

Description Similar to TBL13: Protein trichome birefringence-like 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14530`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g64470`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g02440`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g62390`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g60790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60790

ath:AT2G14530

ath:AT3G02440

ath:AT3G62390

ath:AT5G64470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.527

Rank 1 · LXL04_017283 · OH-1004

Cell membrane0.083

Rank 2 · LXL04_017283 · OH-1004

Extracellular0.070

Rank 3 · LXL04_017283 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_017283 · OH-1004

Nucleus0.032

Rank 5 · LXL04_017283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N69-122 aa

PF13839.13PC-Esterase124-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017283	`PF14416.12`	PMR5N	69	122	8.1e-13	49.2
LXL04_017283	`PF13839.13`	PC-Esterase	124	411	1.4e-68	232.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQR5`	Arabidopsis thaliana	Protein trichome birefringence-like 13	66.923%	Swiss-Prot	strong database homology
`Q9FGE9`	Arabidopsis thaliana	Protein trichome birefringence-like 12	43.020%	Swiss-Prot	moderate database homology
`Q9M896`	Arabidopsis thaliana	Protein trichome birefringence-like 20	32.687%	Swiss-Prot	moderate database homology
`Q9LZQ1`	Arabidopsis thaliana	Protein trichome birefringence-like 6	29.534%	Swiss-Prot	weak database homology
`Q8VYR3`	Arabidopsis thaliana	Protein trichome birefringence-like 2	31.481%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card