Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3987 bp · LXL04_017279|LXL04_017279|OH1004|cDNA
atgAAAACCGTTTTTGCAAGTCGCACCACAGCTGCAGCAGGCTCTATCTTCGAACAgACATTTTATAAAGGTTGTATATCAATGGGGAGTAAGAAAAGGAGCTCTGATAGTGTAGAAGAAGTTGAGAACCAGAAGAGTACTAATACAATCTCTGATACCAAAGTTTCGACTGAGCATTTGAAAAAGAAGATAAAAAAGGTGAAGAAGAACGAAGTGGAGAGTAATAATAAtacaagctctgataccaaagTTTCAAGTGA...
3987 bp · LXL04_017279|LXL04_017279|OH1004|CDS
ATGAAAACCGTTTTTGCAAGTCGCACCACAGCTGCAGCAGGCTCTATCTTCGAACAGACATTTTATAAAGGTTGTATATCAATGGGGAGTAAGAAAAGGAGCTCTGATAGTGTAGAAGAAGTTGAGAACCAGAAGAGTACTAATACAATCTCTGATACCAAAGTTTCGACTGAGCATTTGAAAAAGAAGATAAAAAAGGTGAAGAAGAACGAAGTGGAGAGTAATAATAATACAAGCTCTGATACCAAAGTTTCAAGTGA...
Protein
Download Protein FASTA1328 aa · LXL04_017279|LXL04_017279|OH1004|PROTEIN
MKTVFASRTTAAAGSIFEQTFYKGCISMGSKKRSSDSVEEVENQKSTNTISDTKVSTEHLKKKIKKVKKNEVESNNNTSSDTKVSSEHLKKKIKKVKKNEVEIEKPNDNDNNSNGVKPMERRKKRKALDKEKHRSTTSDDKPEVKPIVTSSEAKEAESRTSNGLPEFHIGVFKDLGSADGSVREAAAERLVMELQAVQKAYDVLEKKEDIDGGLKLEAEKDDGLNNCAPSLRYAVRRLIRGVSSSRECARQGFALGLTML...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_017279 |
|---|---|
| TK1151 ID | TkA02G060470 |
| OH-1004 ID | LXL04_017279 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 97.967Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_017279 |
|---|---|
| Location | Chr03:144929003-144936055 (-) |
| Description | Similar to pol5: rDNA transcriptional regulator pol5 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000027 ribosomal large subunit assembly Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0009303 rRNA transcription Biological Process GO:0022904 respiratory electron transport chain Biological Process GO:0032922 circadian regulation of gene expression Biological Process GO:0042149 cellular response to glucose starvation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process |
| KEGG gene cross-reference | hsa:10514 mmu:18432 rno:60571 sce:YEL055C spo:2539834 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04931.19DNA_pol_phi233-1040 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_017279 | PF04931.19 | DNA_pol_phi | 233 | 1040 | 2.2e-177 | 592.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.