LXL04_016977 | RubberDandelionOmics

Gene overview

LXL04_016977

Reference: OH-1004 Chr: Chr03 Coordinates: 138283094-138287578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1701 bp · LXL04_016977|LXL04_016977|OH1004|cDNA

ATGTCGCTATGGAGGCACACACACGTAGCTATAAAGGGCCACGTGAAACTGTTAGAAACGGGGTATGATCAAATGCTTGGATTCACTGAAAGTCGTGTGCACACTTTCAGCTTGAAGTATTTTCTGTTGTTGACAAATGAACTTTTAAACAAAGTGCTAactttttttggaaacggcgggTGGATCAACGGAAGCCACGCCTCCTTATTCAGAAGGCGTCCCGAGTTCGAGACATCCCGAGGGGCAGTTCGAACACAAGG...

CDS

Download CDS FASTA

1701 bp · LXL04_016977|LXL04_016977|OH1004|CDS

ATGTCGCTATGGAGGCACACACACGTAGCTATAAAGGGCCACGTGAAACTGTTAGAAACGGGGTATGATCAAATGCTTGGATTCACTGAAAGTCGTGTGCACACTTTCAGCTTGAAGTATTTTCTGTTGTTGACAAATGAACTTTTAAACAAAGTGCTAACTTTTTTTGGAAACGGCGGGTGGATCAACGGAAGCCACGCCTCCTTATTCAGAAGGCGTCCCGAGTTCGAGACATCCCGAGGGGCAGTTCGAACACAAGG...

Protein

Download Protein FASTA

566 aa · LXL04_016977|LXL04_016977|OH1004|PROTEIN

MSLWRHTHVAIKGHVKLLETGYDQMLGFTESRVHTFSLKYFLLLTNELLNKVLTFFGNGGWINGSHASLFRRRPEFETSRGAVRTQGVPRDNSPHTGLSAKDLSEHSTTRYLHTPYGLLNPMYHAWPYSNTGPPTGRPDELSTWTNDHLQSQQVIIYAGKANKNAFKALITAEYVGVGIKFAENFEMFVSNKTPKFLKINPYEKVPVLETPDGPLFESNAIARYGKDHDDVIFACNLIFIYCDNVYCVIFVATVSRLKTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016977`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016977

Location Chr03:138283094-138287578 (-)

Description Similar to Elongation factor 1-gamma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57720`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`At1g09640`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0220500`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`Os02g0220600`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016977 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010043 response to zinc ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09640

ath:AT1G57720

dosa:Os02g0220600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · LXL04_016977 · OH-1004

Nucleus0.294

Rank 2 · LXL04_016977 · OH-1004

Mitochondrion0.166

Rank 3 · LXL04_016977 · OH-1004

Endoplasmic reticulum0.130

Rank 4 · LXL04_016977 · OH-1004

Cell membrane0.079

Rank 5 · LXL04_016977 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798.27GST_N154-224 aa

PF13409.13GST_N_2189-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016977	`PF02798.27`	GST_N	154	224	5.1e-12	46.7
LXL04_016977	`PF13409.13`	GST_N_2	189	224	1.3e-06	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVT2`	Arabidopsis thaliana	Probable elongation factor 1-gamma 2	48.106%	Swiss-Prot	weak database homology
`O04487`	Arabidopsis thaliana	Probable elongation factor 1-gamma 1	49.798%	Swiss-Prot	weak database homology
`Q6YW46`	Oryza sativa subsp. japonica	Elongation factor 1-gamma 2	50.183%	Swiss-Prot	weak database homology
`Q9ZRI7`	Oryza sativa subsp. japonica	Elongation factor 1-gamma 1	49.049%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card