LXL04_016689 | RubberDandelionOmics

Gene overview

LXL04_016689

Reference: OH-1004 Chr: Chr03 Coordinates: 130899288-130905290 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3000 bp · LXL04_016689|LXL04_016689|OH1004|cDNA

ATGTATAAGAAAAACGGGAGTGCTAAGCTAACGACAATCAGACAAGATATTGGGGGAAATCAGCGATTGCAGTTGACGGTCCCACCTGATGTGTGGTATGGTGCATTTCCTACAAGAGATTACAACGTATCGATGGTGGATTGGGATTCTTATTCCGTCGTGAAGAATGCACCGAGGGATGCGGAGAAATGTTTTTCGCTGGTGGGGACGACGACAGCGCTGTCGTTTGAATGGAGGAAGGATGCCGGAGATGAGGGAGG...

CDS

Download CDS FASTA

3000 bp · LXL04_016689|LXL04_016689|OH1004|CDS

ATGTATAAGAAAAACGGGAGTGCTAAGCTAACGACAATCAGACAAGATATTGGGGGAAATCAGCGATTGCAGTTGACGGTCCCACCTGATGTGTGGTATGGTGCATTTCCTACAAGAGATTACAACGTATCGATGGTGGATTGGGATTCTTATTCCGTCGTGAAGAATGCACCGAGGGATGCGGAGAAATGTTTTTCGCTGGTGGGGACGACGACAGCGCTGTCGTTTGAATGGAGGAAGGATGCCGGAGATGAGGGAGG...

Protein

Download Protein FASTA

999 aa · LXL04_016689|LXL04_016689|OH1004|PROTEIN

MYKKNGSAKLTTIRQDIGGNQRLQLTVPPDVWYGAFPTRDYNVSMVDWDSYSVVKNAPRDAEKCFSLVGTTTALSFEWRKDAGDEGGAMNGRTIDCDCDIFVVVGGSVLKELGSGTRIIWRVSLRRFPISFRCAPSRLTSANFQISLPEKIDPSREASYTNSNSTLVIRFLQLRQLPYLLIHTLSLLLKSAMDGNDLASDQVIAELIGMGFQVSEATEAIKEVGPSINNAVDFILNASSRNGEASTSSKKPTRKKGLSTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016689`
TK1151 ID	TkA02G111600
OH-1004 ID	LXL04_016689
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 99.144 / OH-1004 81.081 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016689

Location Chr03:130899288-130905290 (-)

Description Similar to RECQSIM: ATP-dependent DNA helicase Q-like SIM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27680`	Plant specific, probable 3'-5' DNA helicase that may play a role in the repair of DNA.	Arabidopsis RecQsim, a plant-specific member of the RecQ helicase family, can suppress the MMS hypersensitivity of the yeast sgs1 mutant.2003 · DOI: 10.1023/a:1023968429220
`At4g35740`	3'-5' DNA helicase that may play a role in the repair of DNA.	Biochemical characterization of AtRECQ3 reveals significant differences relative to other RecQ helicases.2009 · DOI: 10.1104/pp.109.144709

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016689 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000400 four-way junction DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G35740

ath:AT5G27680

xla:373628

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · LXL04_016689 · OH-1004

Cytoplasm0.171

Rank 2 · LXL04_016689 · OH-1004

Mitochondrion0.048

Rank 3 · LXL04_016689 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_016689 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_016689 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD331-501 aa

PF00271.38Helicase_C650-746 aa

PF16124.11RecQ_Zn_bind762-817 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016689	`PF00270.36`	DEAD	331	501	1.2e-26	94.1
LXL04_016689	`PF00271.38`	Helicase_C	650	746	5.2e-18	66.0
LXL04_016689	`PF16124.11`	RecQ_Zn_bind	762	817	3.8e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT69`	Arabidopsis thaliana	ATP-dependent DNA helicase Q-like SIM	52.068%	Swiss-Prot	strong database homology
`Q9FT72`	Arabidopsis thaliana	ATP-dependent DNA helicase Q-like 3	40.611%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card