LXL04_016607 | RubberDandelionOmics

Gene overview

LXL04_016607

Reference: OH-1004 Chr: Chr03 Coordinates: 128783311-128787062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1974 bp · LXL04_016607|LXL04_016607|OH1004|cDNA

ATGGCTCATTCCGGTAACCCAATCTCCGATACCACAAAAGCACTAACATACGACACCGGCATAAAATCGCCTGTTTCGCCATTACGACTTGGACCAGCGCCTAGCAGCAGCTCAAGCTCATCCGGGTCAATATCGGGTCGGAATGAAAACAAACCTCTCCTTCGATCAGCTTCTAGAAAGTCCGTTTCGGGCGGTGCCATTAAAACCCACTCCGGTGAGTTATCGGTTGATAGTTCTCCAAAATGTTCGGCATGCGGCTT...

CDS

Download CDS FASTA

1974 bp · LXL04_016607|LXL04_016607|OH1004|CDS

ATGGCTCATTCCGGTAACCCAATCTCCGATACCACAAAAGCACTAACATACGACACCGGCATAAAATCGCCTGTTTCGCCATTACGACTTGGACCAGCGCCTAGCAGCAGCTCAAGCTCATCCGGGTCAATATCGGGTCGGAATGAAAACAAACCTCTCCTTCGATCAGCTTCTAGAAAGTCCGTTTCGGGCGGTGCCATTAAAACCCACTCCGGTGAGTTATCGGTTGATAGTTCTCCAAAATGTTCGGCATGCGGCTT...

Protein

Download Protein FASTA

657 aa · LXL04_016607|LXL04_016607|OH1004|PROTEIN

MAHSGNPISDTTKALTYDTGIKSPVSPLRLGPAPSSSSSSSGSISGRNENKPLLRSASRKSVSGGAIKTHSGELSVDSSPKCSACGLSASKSGHNPSHSGSGGSSATSPAGNVPPTGNIYPSGKILKTGMITTRTSKSDVLSLGAGNYGHGSIMRGGTGGATTKPAGTEPPVSIIETRKLSRDPEELRKVGNEYYKRGNIIEALGYYDHAISISPEKPAYRCNRGAALMFLDRLNEAAKEYNEALKLDSGYIRAHRRLGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016607`
TK1151 ID	TkAUNG039360
OH-1004 ID	LXL04_016607
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.689 / OH-1004 26.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016607

Location Chr03:128783311-128787062 (+)

Description Similar to TTL1: TPR repeat-containing thioredoxin TTL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53300`	Involved in responses to osmotic stress and abscisic acid (ABA).	The Arabidopsis tetratricopeptide repeat-containing protein TTL1 is required for osmotic stress responses and abscisic acid sensitivity.2006 · DOI: 10.1104/pp.106.085191 The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920
`At2g42580`	Involved in osmotic and salt stress tolerance.	No verified direct reference in this release
`At3g58620`	Involved in osmotic and salt stress tolerance.	The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920
`At3g14950`	Plays a role in the transmission of male gametophyte.	The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016607 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

KEGG gene cross-reference

ath:AT1G53300

ath:AT2G42580

ath:AT3G14950

ath:AT3G58620

mmu:56354

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · LXL04_016607 · OH-1004

Nucleus0.332

Rank 2 · LXL04_016607 · OH-1004

Cell membrane0.096

Rank 3 · LXL04_016607 · OH-1004

Golgi apparatus0.061

Rank 4 · LXL04_016607 · OH-1004

Peroxisome0.051

Rank 5 · LXL04_016607 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13414.13TPR_11191-228 aa

PF13414.13TPR_11233-264 aa

PF00515.35TPR_1459-490 aa

PF00085.27Thioredoxin559-648 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016607	`PF13414.13`	TPR_11	191	228	3.9e-19	68.8
LXL04_016607	`PF13414.13`	TPR_11	233	264	3.9e-19	68.8
LXL04_016607	`PF00515.35`	TPR_1	459	490	4.1e-21	74.6
LXL04_016607	`PF00085.27`	Thioredoxin	559	648	2.6e-11	44.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAH1`	Arabidopsis thaliana	TPR repeat-containing thioredoxin TTL1	56.338%	Swiss-Prot	strong database homology
`Q9SIN1`	Arabidopsis thaliana	Inactive TPR repeat-containing thioredoxin TTL3	47.182%	Swiss-Prot	moderate database homology
`Q84JR9`	Arabidopsis thaliana	TPR repeat-containing thioredoxin TTL4	48.083%	Swiss-Prot	moderate database homology
`F4IXE4`	Arabidopsis thaliana	TPR repeat-containing thioredoxin TTL2	47.659%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card