LXL04_016494 | RubberDandelionOmics

Gene overview

LXL04_016494

Reference: OH-1004 Chr: Chr03 Coordinates: 124853304-124854275 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_016494|LXL04_016494|OH1004|cDNA

ATGGCTGGTGTGCTCGAGATTCTTACTGTTCCTCGTGCTTCCGCCTTTCCGGCGGCGTCTTTGACTCCGATCGTCTCTGCTCCTGTTTCTCGGCTCTCTCATCGCCGGTATATTACAAAATTGCCGGAATCAAGAGGTTTGAGAATCCAGTCGTATGGTTCTTCTGGATCGGTGAGCTTAAGGTCTAAATCTGTCCGCCGTGGAGCACGTATCGTATGCGAGGCTCAAGAAGCCGTCGAAGTTCTTCCAGTCACGGATGC...

CDS

Download CDS FASTA

555 bp · LXL04_016494|LXL04_016494|OH1004|CDS

ATGGCTGGTGTGCTCGAGATTCTTACTGTTCCTCGTGCTTCCGCCTTTCCGGCGGCGTCTTTGACTCCGATCGTCTCTGCTCCTGTTTCTCGGCTCTCTCATCGCCGGTATATTACAAAATTGCCGGAATCAAGAGGTTTGAGAATCCAGTCGTATGGTTCTTCTGGATCGGTGAGCTTAAGGTCTAAATCTGTCCGCCGTGGAGCACGTATCGTATGCGAGGCTCAAGAAGCCGTCGAAGTTCTTCCAGTCACGGATGC...

Protein

Download Protein FASTA

184 aa · LXL04_016494|LXL04_016494|OH1004|PROTEIN

MAGVLEILTVPRASAFPAASLTPIVSAPVSRLSHRRYITKLPESRGLRIQSYGSSGSVSLRSKSVRRGARIVCEAQEAVEVLPVTDATWQSQVLECGLPVLVEFWAPWCGPCRMIHPVIDELAKEYTGKLTCYKVNTDESPSIASRYGIRSIPTVIIFKDGEKKDAVIGAVPKSTLSTCIEKFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016494`
TK1151 ID	TkA02G134240
OH-1004 ID	LXL04_016494
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016494

Location Chr03:124853304-124854275 (-)

Description Similar to At3g15360: Thioredoxin M4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15360`	Thiol-disulfide oxidoreductase involved in the redox regulation of enzyme of the oxidative pentose phosphate pathway.	No verified direct reference in this release
`At1g03680`	Thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0639900`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of chloroplastic enzymes.	No verified direct reference in this release
`Os04g0530600`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of chloroplastic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016494 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0043086 negative regulation of catalytic activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT1G03680

ath:AT3G15360

dosa:Os02g0639900

dosa:Os04g0530600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_016494 · OH-1004

Mitochondrion0.025

Rank 2 · LXL04_016494 · OH-1004

Nucleus0.017

Rank 3 · LXL04_016494 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_016494 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_016494 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin81-181 aa

PF13098.14Thioredoxin_294-183 aa

PF14595.13Thioredoxin_9104-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016494	`PF00085.27`	Thioredoxin	81	181	1.9e-30	105.6
LXL04_016494	`PF13098.14`	Thioredoxin_2	94	183	2.7e-09	38.1
LXL04_016494	`PF14595.13`	Thioredoxin_9	104	174	1.5e-06	28.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEU6`	Arabidopsis thaliana	Thioredoxin M4, chloroplastic	52.880%	Swiss-Prot	strong database homology
`O48737`	Arabidopsis thaliana	Thioredoxin M1, chloroplastic	52.469%	Swiss-Prot	strong database homology
`Q6H7E4`	Oryza sativa subsp. japonica	Thioredoxin M1, chloroplastic	59.184%	Swiss-Prot	strong database homology
`Q7X8R5`	Oryza sativa subsp. japonica	Thioredoxin M2, chloroplastic	57.143%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card