LXL04_015760 | RubberDandelionOmics

Gene overview

LXL04_015760

Reference: OH-1004 Chr: Chr03 Coordinates: 83286172-83294595 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · LXL04_015760|LXL04_015760|OH1004|cDNA

ATGGCTCCCTTATTTCCTACATCCTCTCTCCTTTTCATCTCTCATATTTACATCTCTCTTATTGATCGAACGATCACTTCCTGCGTATATGTATGGATCTTTTTGGGATCGAACGATCTCTTCTTTAGACATCCACCAGCACCGATTTCACCTTTGGTCTACCACGATGATGAGAGAATCGCTATTGAAATCCTGAAATTACAGTCGCCATCGATCCCAAAATCGAAAAGGAAACACATTTTAGGTGCAACCAGGGATAG...

CDS

Download CDS FASTA

1515 bp · LXL04_015760|LXL04_015760|OH1004|CDS

ATGGCTCCCTTATTTCCTACATCCTCTCTCCTTTTCATCTCTCATATTTACATCTCTCTTATTGATCGAACGATCACTTCCTGCGTATATGTATGGATCTTTTTGGGATCGAACGATCTCTTCTTTAGACATCCACCAGCACCGATTTCACCTTTGGTCTACCACGATGATGAGAGAATCGCTATTGAAATCCTGAAATTACAGTCGCCATCGATCCCAAAATCGAAAAGGAAACACATTTTAGGTGCAACCAGGGATAG...

Protein

Download Protein FASTA

504 aa · LXL04_015760|LXL04_015760|OH1004|PROTEIN

MAPLFPTSSLLFISHIYISLIDRTITSCVYVWIFLGSNDLFFRHPPAPISPLVYHDDERIAIEILKLQSPSIPKSKRKHILGATRDRSVSKRWEKLEDIRFEKKTEVGSLSTSMKFGKDCSFLSISVYDWRRYKVIFIFILIKSNLAVFLANAAVSERTESLLSLHSDSLQPLTPVVSYTVFYSVSPFRKFPRCLYQDLRRRRLGRCGRRLGFLLEGNFETTYSSNAMPALKKTEPGDIRQLFERLMKEIGEPVEFELPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015760`
TK1151 ID	TkA02G289150
OH-1004 ID	LXL04_015760
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 99.130 / OH-1004 64.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015760

Location Chr03:83286172-83294595 (+)

Description Similar to ASHH3: Histone-lysine N-methyltransferase ASHH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44150`	Histone methyltransferase.	No verified direct reference in this release
`At3g59960`	Histone methyltransferase.	No verified direct reference in this release
`At4g30860`	Histone methyltransferase (By similarity).	No verified direct reference in this release
`At1g77300`	Histone methyltransferase involved in di and tri-methylation of 'Lys-36' of histone H3 (H3K36me2 and H3K36me3).	Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36.2005 · DOI: 10.1038/ncb1329 Di- and tri- but not monomethylation on histone H3 lysine 36 marks active transcription of genes involved in flowering time regulation and other processes in Arabidopsis thaliana.2008 · DOI: 10.1128/mcb.01607-07 The ASH1 HOMOLOG 2 (ASHH2) histone H3 methyltransferase is required for ovule and anther development in Arabidopsis.2009 · DOI: 10.1371/journal.pone.0007817 Autoimmunity in Arabidopsis acd11 is mediated by epigenetic regulation of an immune receptor.2010 · DOI: 10.1371/journal.ppat.1001137 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015760 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0001763 morphogenesis of a branching structure Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0010363 regulation of plant-type hypersensitive response Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G77300

ath:AT2G44150

ath:AT4G30860

mmu:235626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.629

Rank 1 · LXL04_015760 · OH-1004

Cytoplasm0.280

Rank 2 · LXL04_015760 · OH-1004

Mitochondrion0.092

Rank 3 · LXL04_015760 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_015760 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_015760 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856.34SET352-420 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015760	`PF00856.34`	SET	352	420	8.7e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945S8`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHH3	57.706%	Swiss-Prot	weak database homology
`Q9M1X9`	Arabidopsis thaliana	Putative histone-lysine N-methyltransferase ASHH4	53.137%	Swiss-Prot	weak database homology
`Q949T8`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHR3	40.092%	Swiss-Prot	weak database homology
`Q2LAE1`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHH2	30.045%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card