LXL04_014757 | RubberDandelionOmics

Gene overview

LXL04_014757

Reference: OH-1004 Chr: Chr03 Coordinates: 56402904-56404540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · LXL04_014757|LXL04_014757|OH1004|cDNA

ATGATTAATAAGTATTCTTTTGATGCAGTAACTTGCATACAGTTTAATCTTGTTGATGAAAGATACTTCATAAGTGGATCACTTGATTCAAAAGTCAGGATTTGGAGTATTCCTGATCACCAAGTTGTTGATTGGAATGATATGAAAGAAATGGTTACTGCTGCTTCCTATACACCAGATGGCCAGGCTGTAATAGTTGGTTCCTACAAAGGGAGTTGCTGTTTATACGACACAACTGATGCCCAAACACAGGCGGGAGC...

CDS

Download CDS FASTA

558 bp · LXL04_014757|LXL04_014757|OH1004|CDS

ATGATTAATAAGTATTCTTTTGATGCAGTAACTTGCATACAGTTTAATCTTGTTGATGAAAGATACTTCATAAGTGGATCACTTGATTCAAAAGTCAGGATTTGGAGTATTCCTGATCACCAAGTTGTTGATTGGAATGATATGAAAGAAATGGTTACTGCTGCTTCCTATACACCAGATGGCCAGGCTGTAATAGTTGGTTCCTACAAAGGGAGTTGCTGTTTATACGACACAACTGATGCCCAAACACAGGCGGGAGC...

Protein

Download Protein FASTA

185 aa · LXL04_014757|LXL04_014757|OH1004|PROTEIN

MINKYSFDAVTCIQFNLVDERYFISGSLDSKVRIWSIPDHQVVDWNDMKEMVTAASYTPDGQAVIVGSYKGSCCLYDTTDAQTQAGATFVDEAEILKNVLGERRGHTKGVDRKLKTVSRYPNFFKQQSAERDEINKNLLGMQKQLVEMQQYNKSLLEALRNQFPNFQPPPMPSSQPSSETSNNED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014757`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_014757`
Location	Chr03:56402904-56404540 (+)
Description	Similar to SPBC18H10.05: Uncharacterized WD repeat-containing protein C18H10.05 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014757` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0030334 regulation of cell migration Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0045724 positive regulation of cilium assembly Biological Process GO:0060627 regulation of vesicle-mediated transport Biological Process GO:0061512 protein localization to cilium Biological Process GO:0061824 cytosolic ciliogenesis Biological Process GO:1902018 negative regulation of cilium assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component
KEGG gene cross-reference	bta:286825 mmu:72404 spo:2540832 spo:2543641 xla:734726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.857

Rank 1 · LXL04_014757 · OH-1004

Cytoplasm0.268

Rank 2 · LXL04_014757 · OH-1004

Mitochondrion0.024

Rank 3 · LXL04_014757 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_014757 · OH-1004

Extracellular0.017

Rank 5 · LXL04_014757 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23381.2Beta-prop_IFT122_1st8-83 aa

PF25174.2Beta-prop_THOC38-92 aa

PF25173.2Beta-prop_WDR3_1st8-81 aa

PF25175.2Beta-prop_WDR59-84 aa

PF24814.2WD40_Prp199-83 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd14-64 aa

PF23414.2Beta-prop_EML_220-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014757	`PF23381.2`	Beta-prop_IFT122_1st	8	83	3.5e-10	40.4
LXL04_014757	`PF25174.2`	Beta-prop_THOC3	8	92	5.2e-09	36.2
LXL04_014757	`PF25173.2`	Beta-prop_WDR3_1st	8	81	4e-06	27.4
LXL04_014757	`PF25175.2`	Beta-prop_WDR5	9	84	9.7e-11	42.2
LXL04_014757	`PF24814.2`	WD40_Prp19	9	83	1.8e-06	27.9
LXL04_014757	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	14	64	1e-05	25.7
LXL04_014757	`PF23414.2`	Beta-prop_EML_2	20	85	1e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card